DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and cyb5r3

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001123820.1 Gene:cyb5r3 / 100170571 XenbaseID:XB-GENE-962418 Length:301 Species:Xenopus tropicalis


Alignment Length:283 Identity:157/283 - (55%)
Similarity:205/283 - (72%) Gaps:17/283 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 TLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYTPISS 113
            ||.:|:.||.|.||:||.:|||||||||.|||.:|:||||:||||:|.|.:|..|::|||||:||
 Frog    35 TLENPDIKYALRLIDKEEISHDTRRFRFALPSPEHILGLPIGQHIYLSARVDGNLVVRPYTPVSS 99

  Fly   114 DEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRK 178
            |::.||||||||:|||:.|||||.||||:|:|:.|.:.:.|.||||||.|.|.|.|||.|:..:|
 Frog   100 DDNRGYVDLVVKIYFKNIHPKFPEGGKMSQYLDSLRIDETIDFRGPSGLLTYSGRGTFQIRPDKK 164

  Fly   179 DPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDK-DKTELALLFANQSEKDILLRAELDELAQ 242
            .||....||.:.||||||||||||||.|.|:|  || |||...||||||:|:|||||:||:|:..
 Frog   165 SPPVTKKAKHLGMIAGGTGITPMLQLIRAVMK--DKEDKTICYLLFANQTERDILLRSELEEIRV 227

  Fly   243 KHPDQFKIWYTVDKANEAIKRMPRMGNARFVAWSYNTGHVNDDMMQQHLYPPGEDTLCLLCGPPP 307
            .||.:||:|||:|:|.|              .|.|:.|.||:||:...:.|||::.|.|:|||||
 Frog   228 SHPSRFKLWYTLDRAPE--------------DWDYSQGFVNEDMISSFMPPPGDEVLILMCGPPP 278

  Fly   308 MVNYTCIPGLERLGHRAEQRFSY 330
            |:.|...|.|::|.:..::||:|
 Frog   279 MIQYAINPSLDKLSYPQDRRFAY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 154/279 (55%)
cyt_b5_reduct_like 59..330 CDD:99780 151/271 (56%)
cyb5r3NP_001123820.1 PLN02252 <38..301 CDD:215141 154/278 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 159 1.000 Domainoid score I4034
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 327 1.000 Inparanoid score I2425
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1311668at2759
OrthoFinder 1 1.000 - - FOG0000472
OrthoInspector 1 1.000 - - otm49339
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X606
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.