DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5946 and oxnad1

DIOPT Version :9

Sequence 1:NP_001287035.1 Gene:CG5946 / 39336 FlyBaseID:FBgn0036211 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_031759033.1 Gene:oxnad1 / 100124914 XenbaseID:XB-GENE-971236 Length:328 Species:Xenopus tropicalis


Alignment Length:372 Identity:84/372 - (22%)
Similarity:137/372 - (36%) Gaps:108/372 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVESNFVPLAVGVVA--VLAG-----------------ALIVHYLLNKKSTKPRREPN---RTAR 46
            ||.|:.:.|..|..|  ||.|                 ||... .||::....||:.:   |||.
 Frog     9 IVSSSAMALVAGSAAYQVLRGVTGTFPTQSATLLARAPALCAR-TLNRRRMSSRRQTDHLERTAN 72

  Fly    47 L--RTLVDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELIIRPYT 109
            .  :.::.|     ..:.|..|.|...:|.|..:.:::..  ...||.:....         |..
 Frog    73 TFRQEIISP-----AKVCEITNESATVKRVRLAIANREFT--FKAGQWVDFFI---------PGV 121

  Fly   110 P------ISSD----EDVGYVDLVVKVYFKDSHPKFPAGGKMTQHL--EQLELGDKISFRGPSGR 162
            |      |.|.    |..|.::|.||.   :.||  ||      |.  .|..||.:::.|     
 Frog   122 PKVGGFSICSCPGLLETEGVLELAVKY---NLHP--PA------HWIHSQCTLGSEVAVR----- 170

  Fly   163 LQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITPMLQLAREVLKRSDKDKT---------- 217
               :| |.|.......|.|..:.     :||||.||.|:..:   :|..:|..||          
 Frog   171 ---VG-GEFCFDPQPSDLPLDLV-----LIAGGVGINPLFSI---LLHVADLHKTHEMTGRGFQM 223

  Fly   218 -ELALLFANQSEKDILLRAELDELAQKHPDQFKIWYTVDKANE--AIKRMPRMGNARFVAWSYNT 279
             .:.|.:..::..::|.:..:.:|.:..|.:....:.|.:.:.  .::..|      |:    ..
 Frog   224 GNVKLYYCAKNTGELLFKRNILDLVKSFPGKITCSFHVTQQSSPVCVELQP------FI----TE 278

  Fly   280 GHVNDDMMQQHLYPPGEDTLCLLCGPPPMVNYTCIPGLERLGHRAEQ 326
            |.:.:..:..::   ..|.||.:||||||:..|| ..||.|....||
 Frog   279 GRITEKDLASYV---STDQLCYICGPPPMIESTC-KQLESLHVPKEQ 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5946NP_001287035.1 PTZ00319 51..330 CDD:173521 66/301 (22%)
cyt_b5_reduct_like 59..330 CDD:99780 65/293 (22%)
oxnad1XP_031759033.1 FNR_like 86..325 CDD:99778 65/289 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.