DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and ALKBH1

DIOPT Version :9

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_006011.2 Gene:ALKBH1 / 8846 HGNCID:17911 Length:389 Species:Homo sapiens


Alignment Length:104 Identity:26/104 - (25%)
Similarity:43/104 - (41%) Gaps:20/104 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ESNAIKANLTAYFGKWPETEQKEFRQHMRIITDFISEPEEQ--------QLHEE------IEPYM 73
            |.||.:|.|.. ..||.....|.:...:.|...|:  |..|        :|:.:      ::.:|
Human    74 EQNAYRAGLQP-VSKWQAYGLKGYPGFIFIPNPFL--PGYQWHWVKQCLKLYSQKPNVCNLDKHM 135

  Fly    74 SRLRYEFDHWDDAIHGFRETERKKWFPKNREILERVRQV 112
            |:...: |.|:.:....|..|..|..|  |.:||::|.|
Human   136 SKEETQ-DLWEQSKEFLRYKEATKRRP--RSLLEKLRWV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14130NP_648511.2 None
ALKBH1NP_006011.2 tRNA-binding. /evidence=ECO:0000305|PubMed:27745969 86..389 21/91 (23%)
alkb 119..289 CDD:129659 14/56 (25%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q6NS38 175..177
Alpha-ketoglutarate binding. /evidence=ECO:0000250|UniProtKB:Q96Q83 220..222
Alpha-ketoglutarate binding. /evidence=ECO:0000250|UniProtKB:Q96Q83 338..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.