DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and ALKBH7

DIOPT Version :9

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_016882844.1 Gene:ALKBH7 / 84266 HGNCID:21306 Length:273 Species:Homo sapiens


Alignment Length:165 Identity:70/165 - (42%)
Similarity:92/165 - (55%) Gaps:36/165 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FISEPEEQQLHEEIEPYMSRLRYEFDHWDDAIHGFRETERKKWFPKNREILERVRQVAF--DGAV 118
            |:|..||:.|..|:||.:.|.|||:||||.|||||||||:.:|...:|.||:||:..||  ...:
Human    39 FLSTAEEETLSRELEPELRRRRYEYDHWDAAIHGFRETEKSRWSEASRAILQRVQAAAFGPGQTL 103

  Fly   119 MPYVHILDLAPDGVIKPHVDSTRYCGNTISGISLLSDSVMRLVRTDEQRYQQQSSGTATDPNSQG 183
            :..||:|||...|.|||||||.::||.||:|:||||.||||||.|.|             |..  
Human   104 LSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQE-------------PGE-- 153

  Fly   184 SEPDAAYRHQPEASLKNNFYADILLPRRSLYIMSH 218
                               :.::||...||||:.:
Human   154 -------------------WLELLLEPGSLYILRY 169



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147837
Domainoid 1 1.000 107 1.000 Domainoid score I6546
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11964
Inparanoid 1 1.050 161 1.000 Inparanoid score I4240
Isobase 1 0.950 - 0 Normalized mean entropy S3668
OMA 1 1.010 - - QHG58977
OrthoDB 1 1.010 - - D1181737at2759
OrthoFinder 1 1.000 - - FOG0005759
OrthoInspector 1 1.000 - - oto88938
orthoMCL 1 0.900 - - OOG6_105564
Panther 1 1.100 - - LDO PTHR21052
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4043
SonicParanoid 1 1.000 - - X5480
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.