DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and AT5G01780

DIOPT Version :10

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001190202.1 Gene:AT5G01780 / 831672 AraportID:AT5G01780 Length:442 Species:Arabidopsis thaliana


Alignment Length:142 Identity:32/142 - (22%)
Similarity:52/142 - (36%) Gaps:39/142 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 ETERKKWF---PKNREILE--------RVRQVAFDGAVMPYVHI--------LDLAPDGVIKPHV 137
            :|..|.|.   ..|||.:|        |...|.....:.|.:.:        |.:.|.|..:|  
plant   196 DTSIKDWILADETNRETVEVSNKHKVIRPGMVLLKDFLTPDIQVDIVKTCRELGVKPTGFYQP-- 258

  Fly   138 DSTRYCGNTISGISLLSDSVMRLVRT-DEQ-RYQQQSSGTATDPNSQGSEPDAAYRHQPEASLKN 200
                  |.::.  |.|...:|.|.|. |.| :|::.     ||.:|:..|....:....|.:::.
plant   259 ------GYSVG--SKLHLQMMCLGRNWDPQTKYRKN-----TDIDSKAPEIPVTFNVLVEKAIRE 310

  Fly   201 NFYADILLPRRS 212
               |..|:.|.|
plant   311 ---AHALIDRES 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14130NP_648511.2 None
AT5G01780NP_001190202.1 2OG-FeII_Oxy_2 225..440 CDD:433285 24/113 (21%)

Return to query results.
Submit another query.