DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and AT4G02485

DIOPT Version :9

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001319847.1 Gene:AT4G02485 / 827953 AraportID:AT4G02485 Length:226 Species:Arabidopsis thaliana


Alignment Length:163 Identity:43/163 - (26%)
Similarity:63/163 - (38%) Gaps:52/163 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 REILERV-----------RQVAFDGAVMPYVHILDLAPDGVIKPHVDSTRYCGNTISGISLLSDS 156
            ||.||.|           |:..||..::....     |...|..|||..|: .:.|:.:||.|..
plant    98 RETLESVDLPVLSADLLWREPLFDQLIVNLYQ-----PGEGICAHVDLLRF-EDGIAIVSLESPC 156

  Fly   157 VMRLVRTDEQRYQQQSSGTATDPNSQGSEPDAAYRHQPEASLKNNFYADILLPRRSLYIMSHTAR 221
            |||....::..|:.                                 .|:||...||.:||..||
plant   157 VMRFSPAEKNEYEA---------------------------------VDVLLNPGSLILMSGEAR 188

  Fly   222 YKFTHEILAKEH--SQFQGALVPRTRRISIICR 252
            |::.|||..|::  ..::|..:.:.|||||..|
plant   189 YRWKHEINRKQNGFQLWEGEEIDQKRRISITLR 221



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21052
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.