DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and alkbh3

DIOPT Version :9

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001003511.2 Gene:alkbh3 / 792266 ZFINID:ZDB-GENE-040801-254 Length:282 Species:Danio rerio


Alignment Length:297 Identity:55/297 - (18%)
Similarity:93/297 - (31%) Gaps:112/297 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GKWPETEQKEFRQHMRIIT------DFISEPEEQQLHEEIEPY---------------------- 72
            |.|.:..||..|..::.:.      .:.|.|:..:.|:..:|.                      
Zfish    12 GSWAKPVQKPQRPSVQDVQSASASGSWKSGPQSFEFHQPADPIRKVPAEKVIENAGDYEISQGPS 76

  Fly    73 -MSRLRYEFDHWDDAIHGFRETERKKW--------FPKNREILERVRQVAFDG-------AVMPY 121
             :||||        .|.||...|...|        .|.:::...|:...|::.       ..:||
Zfish    77 GVSRLR--------LIPGFLLQEEADWMFSKLLAELPWSQKTNYRMMGDAYEEPRLTCWYGELPY 133

  Fly   122 VHILDLAPDGVIKPHVDSTRYCGNTISGISLLSDSVMRLVRTDEQR------------YQ--QQS 172
            .                   |..:|:...:.....:..|....||:            |:  :.|
Zfish   134 T-------------------YSRSTMEANAQWHPVLATLRLAVEQKSAHKFNSLLCNLYRDGKDS 179

  Fly   173 SGTATDPN-SQGSEPDAA-----------YRHQPEASLKNNF-YAD---ILLPRRSLYIMSHTAR 221
            .|..:|.. |.|.:|..|           .|.||....|.:| |.:   :.|...:|.:|....:
Zfish   180 IGWHSDSEPSLGPQPIIASLSLGDTRVFSLRKQPLPEDKGDFTYVERIRVPLAHGTLLLMEGCTQ 244

  Fly   222 YKFTHEILAKEHSQFQGALVPRTRRISIICRN---EP 255
            ..:.|:: |||:..       |..||::..|.   ||
Zfish   245 ADWQHQV-AKEYHD-------RGPRINLTFRTIYPEP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14130NP_648511.2 None
alkbh3NP_001003511.2 2OG-FeII_Oxy_2 81..267 CDD:290266 41/220 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.