DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and Alkbh7

DIOPT Version :9

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001102854.1 Gene:Alkbh7 / 679944 RGDID:1598126 Length:221 Species:Rattus norvegicus


Alignment Length:202 Identity:93/202 - (46%)
Similarity:119/202 - (58%) Gaps:36/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FISEPEEQQLHEEIEPYMSRLRYEFDHWDDAIHGFRETERKKWFPKNREILERVRQVAF--DGAV 118
            |:|:.||..|..|:||.:.|.|||:||||.|||||||||:..|...::.||:|||..||  |..:
  Rat    39 FLSQEEEDTLTRELEPQLRRRRYEYDHWDSAIHGFRETEKSCWSDASQAILQRVRAAAFGPDQTL 103

  Fly   119 MPYVHILDLAPDGVIKPHVDSTRYCGNTISGISLLSDSVMRLVRTDEQRYQQQSSGTATDPNSQG 183
            :..||:|||...|.|||||||.::||:||:|:||||.|||:||.|.|                  
  Rat   104 LSLVHVLDLEHRGYIKPHVDSVKFCGSTIAGLSLLSPSVMKLVHTQE------------------ 150

  Fly   184 SEPDAAYRHQPEASLKNNFYADILLPRRSLYIMSHTARYKFTHEILAKEHSQFQGALVPRTRRIS 248
                      ||.      :.::||...||||:..:|||.|:||||..|.|.|....|||.||||
  Rat   151 ----------PEQ------WLELLLEPGSLYILRGSARYDFSHEILRDEESFFGAHRVPRGRRIS 199

  Fly   249 IICRNEP 255
            :|||:.|
  Rat   200 VICRSLP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14130NP_648511.2 None
Alkbh7NP_001102854.1 2OG-FeII_Oxy 33..200 CDD:419693 88/194 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341696
Domainoid 1 1.000 103 1.000 Domainoid score I6652
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11964
Inparanoid 1 1.050 166 1.000 Inparanoid score I4083
OMA 1 1.010 - - QHG58977
OrthoDB 1 1.010 - - D1181737at2759
OrthoFinder 1 1.000 - - FOG0005759
OrthoInspector 1 1.000 - - oto96070
orthoMCL 1 0.900 - - OOG6_105564
Panther 1 1.100 - - LDO PTHR21052
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5480
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.