DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and alkbh5

DIOPT Version :10

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001070855.1 Gene:alkbh5 / 570158 ZFINID:ZDB-GENE-061013-602 Length:352 Species:Danio rerio


Alignment Length:218 Identity:45/218 - (20%)
Similarity:62/218 - (28%) Gaps:93/218 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EEIEPYMSRL--RYEFDHWDDAIHGFRETERKKWFPKNREILERV--RQVAFDGAVMPYVHILDL 127
            |:..|...||  :.|.|...|.:|..              :::|:  ..|..:|.|...| |.|.
Zfish   114 EKRGPGQERLYSKGEVDDIPDWVHEL--------------VIDRLVTHGVIPEGFVNSAV-INDY 163

  Fly   128 APDGVIKPHVDSTRYCGNTISGISLLSDS------------------------------------ 156
            .|.|.|..|||........|..:|..|||                                    
Zfish   164 QPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFLFKPIRVSEPVLHLPVRRGSVTVLSGYA 228

  Fly   157 --------------------VMRLVRTDEQRYQQQS-SGTATDP----------NSQGSEPDAAY 190
                                ::|..|.|..|....| |.:...|          :.:.::|||| 
Zfish   229 ADDITHCIRPQDIKERRAVIILRKTRADAPRLDSNSLSPSIVSPKRRHILKAKRSHRKADPDAA- 292

  Fly   191 RHQPEASLKNNFYADILLPRRSL 213
             |:|..     ...|..|.||||
Zfish   293 -HRPRV-----LEMDKELQRRSL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14130NP_648511.2 None
alkbh5NP_001070855.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..47
2OG-FeII_Oxy <104..238 CDD:473886 26/138 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..352 15/57 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.