DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and alkbh2

DIOPT Version :9

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001243613.1 Gene:alkbh2 / 569291 ZFINID:ZDB-GENE-060526-327 Length:258 Species:Danio rerio


Alignment Length:135 Identity:27/135 - (20%)
Similarity:47/135 - (34%) Gaps:59/135 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RYEFDHWDDAIHGFRETERK-------------------------KWFPKNREILERVRQVAFDG 116
            ||:..|  |.|...|:.||:                         :..|:.|:| |.|:....:|
Zfish   150 RYKDGH--DHIGEHRDDERELDPACPIASVSLGAARHLIFRHRDARTGPRKRQI-EPVKLELANG 211

  Fly   117 AVM----P----YVHILDLAPDGVIKPHVDSTRYCGNTISGISLLSDSVMRLVRTDEQRYQQQSS 173
            :::    |    :.|.|.:... ||.|.::.|                ..|:|:      .:|.:
Zfish   212 SLLLMNFPTNTYWYHSLPIRKK-VITPRINLT----------------FRRIVK------NRQKN 253

  Fly   174 GTATD 178
            ||.|:
Zfish   254 GTKTE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14130NP_648511.2 None
alkbh2NP_001243613.1 2OG-FeII_Oxy_2 62..244 CDD:290266 21/113 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.