DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and alkbh1

DIOPT Version :9

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001018527.1 Gene:alkbh1 / 553720 ZFINID:ZDB-GENE-050522-196 Length:363 Species:Danio rerio


Alignment Length:74 Identity:17/74 - (22%)
Similarity:37/74 - (50%) Gaps:10/74 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PETEQKEFRQHMRIITDFISEPEEQQLHEEIEPYMSRLRYEFDHWDDAIHGFRETERKKWFPKNR 103
            |.::|...:|.::|.      |::..:. .::.:||.:..| :.|:.:|...:....:|..||. 
Zfish    89 PGSQQFWVKQCLKIY------PQKPNVC-NLDMHMSSVDTE-NIWERSIDAIQRKGNRKREPKT- 144

  Fly   104 EILERVRQV 112
             :||::|.|
Zfish   145 -LLEKLRWV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14130NP_648511.2 None
alkbh1NP_001018527.1 2OG-FeII_Oxy 100..270 CDD:304390 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.