powered by:
Protein Alignment CG14130 and alkbh1
DIOPT Version :9
Sequence 1: | NP_648511.2 |
Gene: | CG14130 / 39335 |
FlyBaseID: | FBgn0036210 |
Length: | 255 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001018527.1 |
Gene: | alkbh1 / 553720 |
ZFINID: | ZDB-GENE-050522-196 |
Length: | 363 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 17/74 - (22%) |
Similarity: | 37/74 - (50%) |
Gaps: | 10/74 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 PETEQKEFRQHMRIITDFISEPEEQQLHEEIEPYMSRLRYEFDHWDDAIHGFRETERKKWFPKNR 103
|.::|...:|.::|. |::..:. .::.:||.:..| :.|:.:|...:....:|..||.
Zfish 89 PGSQQFWVKQCLKIY------PQKPNVC-NLDMHMSSVDTE-NIWERSIDAIQRKGNRKREPKT- 144
Fly 104 EILERVRQV 112
:||::|.|
Zfish 145 -LLEKLRWV 152
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14130 | NP_648511.2 |
None |
alkbh1 | NP_001018527.1 |
2OG-FeII_Oxy |
100..270 |
CDD:304390 |
14/63 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3145 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.