DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and alkbh7

DIOPT Version :9

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001017609.1 Gene:alkbh7 / 550272 ZFINID:ZDB-GENE-050417-78 Length:233 Species:Danio rerio


Alignment Length:272 Identity:111/272 - (40%)
Similarity:152/272 - (55%) Gaps:67/272 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIGHILRRCHRQAV----------ESNAIKANLTAYFGKWPE-TEQKEF------------RQHM 50
            |:..:.|:..|:::          ||:|::        |.|| |::.::            |..:
Zfish     3 LLIRVSRQIQRKSLQNTSLYRIFSESSALR--------KGPECTDECKWLCGSSEEILSAVRGQV 59

  Fly    51 RIITDFISEPEEQQLHEEIEPYMSRLRYEFDHWDDAIHGFRETERKKWFPKNREILERVRQVAF- 114
            .:..:||||.||..|.:|:|..:.:.|||||||||||||:|||||.:|...:..||.|||.||| 
Zfish    60 EVRQNFISEEEENALFKEVEAGLRKKRYEFDHWDDAIHGYRETERLQWGAASENILRRVRTVAFP 124

  Fly   115 DGA-VMPYVHILDLAPDGVIKPHVDSTRYCGNTISGISLLSDSVMRLVRTDEQRYQQQSSGTATD 178
            :|: ::..||:|||...|.||||:||.::||:||:|:||||||:||||                 
Zfish   125 EGSPLLGPVHVLDLDKKGYIKPHIDSVKFCGSTIAGLSLLSDSIMRLV----------------- 172

  Fly   179 PNSQGSEPDAAYRHQPEASLKNNFYADILLPRRSLYIMSHTARYKFTHEILAKEHSQFQGALVPR 243
                           ||.:..:.  .|:||.||||||:...||:|||||||..|.|.|.|..|||
Zfish   173 ---------------PENNTTDR--VDLLLSRRSLYILRDDARFKFTHEILKDEESFFSGQKVPR 220

  Fly   244 TRRISIICRNEP 255
            .||||:||||.|
Zfish   221 HRRISVICRNLP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14130NP_648511.2 None
alkbh7NP_001017609.1 2OG-FeII_Oxy <144..207 CDD:304390 40/96 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581707
Domainoid 1 1.000 179 1.000 Domainoid score I3482
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11964
Inparanoid 1 1.050 180 1.000 Inparanoid score I3998
OMA 1 1.010 - - QHG58977
OrthoDB 1 1.010 - - D1181737at2759
OrthoFinder 1 1.000 - - FOG0005759
OrthoInspector 1 1.000 - - oto39420
orthoMCL 1 0.900 - - OOG6_105564
Panther 1 1.100 - - LDO PTHR21052
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4043
SonicParanoid 1 1.000 - - X5480
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.