DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and ALKBH5

DIOPT Version :9

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_060228.3 Gene:ALKBH5 / 54890 HGNCID:25996 Length:394 Species:Homo sapiens


Alignment Length:298 Identity:59/298 - (19%)
Similarity:98/298 - (32%) Gaps:121/298 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ETEQKEFRQHMRIITDFISEPEEQQLHEEIEPYMSR---------------LRYEFDHWDDAIHG 89
            |.|.::.:..:|.:..| |:.|..::...|:..:||               ||.::...:...:|
Human    79 EEEARKVKSGIRQMRLF-SQDECAKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFFGEGYTYG 142

  Fly    90 FRETER----KKWFPKN--REILERVRQVAF----DGAVMP--YVH---ILDLAPDGVIKPHVDS 139
            .:..:|    ::.:|..  .||.|.|.|:..    :..|:|  :|:   |.|..|.|.|..|||.
Human   143 AQLQKRGPGQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDP 207

  Fly   140 TRYCGNTISGISLLSDS------------------------------------------------ 156
            .......|..:|..|||                                                
Human   208 IHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQD 272

  Fly   157 --------VMRLVRTDEQRYQQQS---------------SGTATDP------NSQGSEPDAAYRH 192
                    ::|..|.|..|.:.:|               ||...||      :.:.::||||  |
Human   273 IKERRAVIILRKTRLDAPRLETKSLSSSVLPPSYASDRLSGNNRDPALKPKRSHRKADPDAA--H 335

  Fly   193 QP---EASLKNNFYADILLPRRSLYIMSHTARYKFTHE 227
            :|   |...:.|        |||:.:.:|..|..|:.|
Human   336 RPRILEMDKEEN--------RRSVLLPTHRRRGSFSSE 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14130NP_648511.2 None
ALKBH5NP_060228.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..83 2/3 (67%)
2OG-FeII_Oxy <136..270 CDD:389772 24/133 (18%)
Alpha-ketoglutarate binding. /evidence=ECO:0000269|PubMed:24778178 193..195 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..394 19/77 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.