DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and ofd2

DIOPT Version :9

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_594941.1 Gene:ofd2 / 2541495 PomBaseID:SPAP8A3.02c Length:225 Species:Schizosaccharomyces pombe


Alignment Length:244 Identity:51/244 - (20%)
Similarity:86/244 - (35%) Gaps:92/244 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CHRQAVESNAIK---ANLTAYFGKWPETE-QKEFRQHMRIITDFISEPEEQQLHEEIEPYMSRLR 77
            |..::|:.|.|.   ..|.:.:|...::. ...|..|:..:.|:|....:|:|            
pombe    57 CLPESVQRNLINNVPKELLSIYGSGKQSHLYIPFPAHINCLNDYIPSDFKQRL------------ 109

  Fly    78 YEFDHWDDAIHGFRETERKKWFPKNREILERVRQVAFDGAVMPYVHILDLAPDGVIKPHVDSTRY 142
                                |..::.|.:  :.||...|             ||:| ||.|...:
pombe   110 --------------------WKGQDAEAI--IMQVYNPG-------------DGII-PHKDLEMF 138

  Fly   143 CGNTISGISLLSDSVMRLVRTDEQRYQQQSSGTATDPNSQGSEPDAAYRHQPEASLKNNFYADIL 207
             |:.::..|.||::.|                              .:.| ||..||:.    |.
pombe   139 -GDGVAIFSFLSNTTM------------------------------IFTH-PELKLKSK----IR 167

  Fly   208 LPRRSLYIMSHTARYKFTHEILAKE----HSQFQGALVPRTRRISIICR 252
            |.:.||.:||.||||.:.|||..:.    .:..:...|.|::|:|:..|
pombe   168 LEKGSLLLMSGTARYDWFHEIPFRAGDWVMNDGEEKWVSRSQRLSVTMR 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14130NP_648511.2 None
ofd2NP_594941.1 AlkB 1..196 CDD:225687 46/222 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.