DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG14130 and ALKBH3

DIOPT Version :9

Sequence 1:	NP_648511.2	Gene:	CG14130 / 39335	FlyBaseID:	FBgn0036210	Length:	255	Species:	Drosophila melanogaster
Sequence 2:	NP_631917.1	Gene:	ALKBH3 / 221120	HGNCID:	30141	Length:	286	Species:	Homo sapiens

Alignment Length:	69	Identity:	15/69 - (21%)
Similarity:	26/69 - (37%)	Gaps:	24/69 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly    31 LTAYFGKWPETEQK---EFRQH----MRIITDFI-----------------SEPEEQQLHEEIEP 71
            |||::|:.|.|..:   |...|    :|.:.:.|                 :|.:....|.:.||
Human   132 LTAWYGELPYTYSRITMEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEP 196

  Fly    72 YMSR 75
            .:.|
Human   197 SLGR 200

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG14130	NP_648511.2	None
ALKBH3	NP_631917.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	21..45
		2OG-FeII_Oxy	90..275	CDD:328754	15/69 (22%)
		Substrate binding. /evidence=ECO:0000250\|UniProtKB:Q6NS38	141..143		0/1 (0%)
		Alpha-ketoglutarate binding. /evidence=ECO:0000269\|PubMed:16858410, ECO:0007744\|PDB:2IUW	179..181		0/1 (0%)
		Alpha-ketoglutarate binding. /evidence=ECO:0000269\|PubMed:16858410, ECO:0007744\|PDB:2IUW	269..275
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG3145
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900