DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and Alkbh1

DIOPT Version :10

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001096035.1 Gene:Alkbh1 / 211064 MGIID:2384034 Length:389 Species:Mus musculus


Alignment Length:130 Identity:29/130 - (22%)
Similarity:43/130 - (33%) Gaps:49/130 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 WDDAIHGFRETERKKWFPKNREILERVRQVAFDGAVMPYVHILDLAPDGVIKPHVDSTRYCGNTI 147
            |:.:....|..|..|..|  |.:|||:|.|     .:.|.:            :.||.:|..:..
Mouse   144 WEQSKEVLRSKEVTKRRP--RSLLERLRWV-----TLGYHY------------NWDSKKYSADHY 189

  Fly   148 ----SGISLLSDSVMRLVRTDEQRYQQQSSGTATDPNSQGSEPDAAYRHQPEASLKNNFYADILL 208
                |.::.||:.|                  ||....||        .|.||.:.|.:..|..|
Mouse   190 TPFPSDLAFLSEQV------------------ATACGFQG--------FQAEAGILNYYRLDSTL 228

  Fly   209  208
            Mouse   229  228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14130NP_648511.2 None
Alkbh1NP_001096035.1 Interaction with DNAJB6. /evidence=ECO:0000269|PubMed:18163532 1..127
tRNA-binding. /evidence=ECO:0000250|UniProtKB:Q13686 86..389 29/130 (22%)
2OG-FeII_Oxy 119..289 CDD:473886 29/130 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.