DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and ALKBH2

DIOPT Version :9

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001001655.1 Gene:ALKBH2 / 121642 HGNCID:32487 Length:261 Species:Homo sapiens


Alignment Length:248 Identity:49/248 - (19%)
Similarity:86/248 - (34%) Gaps:85/248 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VESNAIKANLTAYFGKWPETEQKEFRQHMRIITDFISEPEE--QQLHEEIEPY---MSRLRYEFD 81
            :.:..:..:.|..|||                    :|.:|  |:|.:|:|.:   ::|::. |.
Human    60 IRAEGLDCSYTVLFGK--------------------AEADEIFQELEKEVEYFTGALARVQV-FG 103

  Fly    82 HW----------DDAIHGFRET------ERKKWFPKNREILERVRQ--VAFDGAVMPYVHILDLA 128
            .|          .||  |...|      ..|.|.|    :|||:|.  ....|....:| :::..
Human   104 KWHSVPRKQATYGDA--GLTYTFSGLTLSPKPWIP----VLERIRDHVSGVTGQTFNFV-LINRY 161

  Fly   129 PDGVIKPHVDSTRYCGNTISGISLLSDSVMRLVRTDEQRYQQQSSGTATDPNSQGSEPDAAYRHQ 193
            .||.  .|:...|                      |::|  :.:.|:.....|.|:..|..:||:
Human   162 KDGC--DHIGEHR----------------------DDER--ELAPGSPIASVSFGACRDFVFRHK 200

  Fly   194 -PEASLKNNFYADILLP--RRSLYIMSHTARYKFTHEILAKEHSQFQGALVPR 243
             ......:...|.:.||  ..||.:|:|.....:.|.:..::.     .|.||
Human   201 DSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKK-----VLAPR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14130NP_648511.2 None
ALKBH2NP_001001655.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57
2OG-FeII_Oxy_2 72..254 CDD:316090 48/236 (20%)
Substrate binding. /evidence=ECO:0000269|PubMed:18432238 102..104 1/1 (100%)
Substrate binding. /evidence=ECO:0000269|PubMed:18432238 122..124 0/1 (0%)
Alpha-ketoglutarate binding. /evidence=ECO:0000269|PubMed:18432238 159..161 0/1 (0%)
Alpha-ketoglutarate binding. /evidence=ECO:0000269|PubMed:18432238 248..254 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.