DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14130 and alkbh7

DIOPT Version :9

Sequence 1:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_002940667.2 Gene:alkbh7 / 100491971 XenbaseID:XB-GENE-958693 Length:246 Species:Xenopus tropicalis


Alignment Length:210 Identity:98/210 - (46%)
Similarity:123/210 - (58%) Gaps:40/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 MRIITDFISEPEEQQLHEEIEPYMSRLRYEFDHWDDAIHGFRETERKKWFPKNREILERVRQVAF 114
            :.::.||:|..||..|..|:||.:.|.|||..|||:||||||||||.:|.|:|..:|:|||:.||
 Frog    71 LTVVPDFVSPAEESVLFGELEPVLKRKRYEGGHWDEAIHGFRETERLQWSPENSAVLQRVREKAF 135

  Fly   115 DGA--VMPYVHILDLAPDGVIKPHVDSTRYCGNTISGISLLSDSVMRLVRTD--EQRYQQQSSGT 175
            ...  .:..||:|||..:|.||.||||.::||:||:||.|||.|:||||..|  |:|        
 Frog   136 PPGEEQLSLVHVLDLKKEGYIKAHVDSVKFCGSTIAGICLLSSSIMRLVSVDNSEER-------- 192

  Fly   176 ATDPNSQGSEPDAAYRHQPEASLKNNFYADILLPRRSLYIMSHTARYKFTHEILAKEHSQFQGAL 240
                                        ||:|||||.||::|...||.||||||..|.|.|.||.
 Frog   193 ----------------------------ADLLLPRRCLYVLSGKVRYNFTHEILRDEESFFNGAH 229

  Fly   241 VPRTRRISIICRNEP 255
            |.|.||||:||||.|
 Frog   230 VQRERRISVICRNLP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14130NP_648511.2 None
alkbh7XP_002940667.2 2OG-FeII_Oxy <156..217 CDD:304390 38/96 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6120
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11964
Inparanoid 1 1.050 178 1.000 Inparanoid score I3911
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1181737at2759
OrthoFinder 1 1.000 - - FOG0005759
OrthoInspector 1 1.000 - - oto102805
Panther 1 1.100 - - LDO PTHR21052
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4043
SonicParanoid 1 1.000 - - X5480
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.190

Return to query results.
Submit another query.