DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42255 and MFRP

DIOPT Version :9

Sequence 1:NP_729748.3 Gene:CG42255 / 39334 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster
Sequence 2:NP_113621.1 Gene:MFRP / 83552 HGNCID:18121 Length:579 Species:Homo sapiens


Alignment Length:478 Identity:114/478 - (23%)
Similarity:173/478 - (36%) Gaps:135/478 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1468 SSLSVSAPSGYNSSVVLFRSCHEETQTQTFTSPGNELVIRFVSSSAPSRKYFKASFV--QVPASC 1530
            :.|..:.|||.:.|.:........|.|.|.|:          |.:|.:.|..:.|.|  ...::|
Human    90 AQLQAAPPSGASHSPLPAGGLTTTTTTPTITT----------SQAAGTPKGQQESGVSPSPQSTC 144

  Fly  1531 GGYISASSGVLTTPGFHNHQDSKNVANYTSNIECVWTVEVTNGYGIRPHFEQFNLTDSGNCSVSF 1595
            ||.:|...|..::|   |:.|.     |..|..|||.::|...:.|:...|..::....:|....
Human   145 GGLLSGPRGFFSSP---NYPDP-----YPPNTHCVWHIQVATDHAIQLKIEALSIESVASCLFDR 201

  Fly  1596 VELTKLEPDNKEIFLEKTCGEDSPMIRIVHGRKLRVRFKSQAGTWG-RFIMYFERQCGGRLSTGE 1659
            :||:. ||:..   |.:.||...|.....:...|.|.|.|.:...| .|..:::....||.|...
Human   202 LELSP-EPEGP---LLRVCGRVPPPTLNTNASHLLVVFVSDSSVEGFGFHAWYQAMAPGRGSCAH 262

  Fly  1660 GYLQSRLDE-ECSWLVTSPEGSKLSLIINQLECPKCNAVSQ---NCSEGLQLLNDDDQVLLYQMC 1720
                   || .|                :||.|...::|..   ||::|....|          |
Human   263 -------DEFRC----------------DQLICLLPDSVCDGFANCADGSDETN----------C 294

  Fly  1721 RDHPANLIVPANNVRILTHGIRLQAQFSTFENSCGGNITSASGSLSSPNYPDSYPANIECVWSIR 1785
                                   .|:||    .||||:|...|:.|:|:|...||..:.|.|.|.
Human   295 -----------------------SAKFS----GCGGNLTGLQGTFSTPSYLQQYPHQLLCTWHIS 332

  Fly  1786 TRPGNALEITFEAMDIVRSEHCNDDFLEI---RSSVQGPLLALYCDKNLPETPLVVHSELWIKFR 1847
            ...|:::|:.|....:...:.|..|::|:   .||....||..:|....|...:..|.||.:.||
Human   333 VPAGHSIELQFHNFSLEAQDECKFDYVEVYETSSSGAFSLLGRFCGAEPPPHLVSSHHELAVLFR 397

  Fly  1848 SRPGNTAGGFRFRWTYVHNNEINSGINGTIEPPPPLFVSNE-----------DQPFTWRLFTDFK 1901
            :..|.::|||..  ||:       ..|.|..|..|..:|.:           |.   ||..|   
Human   398 TDHGISSGGFSA--TYL-------AFNATENPCGPSELSCQAGGCKGVQWMCDM---WRDCT--- 447

  Fly  1902 KVFVLQFEEYISGLILFDGYDDN 1924
                             ||.|||
Human   448 -----------------DGSDDN 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42255NP_729748.3 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:278437
EGF_CA 462..496 CDD:238011
CUB 503..619 CDD:238001
CUB 624..738 CDD:238001
CUB 745..854 CDD:238001
CUB 857..963 CDD:238001
CUB 1066..1179 CDD:238001
CUB 1185..1293 CDD:238001
CUB 1303..1406 CDD:238001
CUB 1411..1523 CDD:238001 12/54 (22%)
CUB 1530..1648 CDD:238001 31/118 (26%)
CUB 1754..1862 CDD:238001 35/110 (32%)
CUB 1979..2091 CDD:238001
CUB 2096..2193 CDD:294042
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:294042
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:294042
CUB 3499..3607 CDD:238001
MFRPNP_113621.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..143 10/52 (19%)
CUB 144..252 CDD:238001 31/119 (26%)
LDLa 260..294 CDD:238060 11/66 (17%)
CUB 301..411 CDD:238001 35/111 (32%)
LDLa 421..454 CDD:238060 11/56 (20%)
Fz 466..569 CDD:279700
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4292
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.