DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42255 and TLL1

DIOPT Version :9

Sequence 1:NP_729748.3 Gene:CG42255 / 39334 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster
Sequence 2:NP_036596.3 Gene:TLL1 / 7092 HGNCID:11843 Length:1013 Species:Homo sapiens


Alignment Length:979 Identity:228/979 - (23%)
Similarity:362/979 - (36%) Gaps:289/979 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   577 GRFCGSRLPMTNGSVITTQEQ--VFFWFRSDNQTQGKGFHVIWNSLPFSCGETINLTSTQTGVLR 639
            |.|.||:..|...::...::.  |.|..|||.::     ::::...|..|...:           
Human   168 GNFTGSQRAMFKQAMRHWEKHTCVTFIERSDEES-----YIVFTYRPCGCCSYV----------- 216

  Fly   640 SPGYPGQARPELDCRWQLTAPFGYRLLLRFYDISLGSSEASAGNCSQDSLIVY------------ 692
              |..|.. |:.                    ||:|.      ||.:..::|:            
Human   217 --GRRGNG-PQA--------------------ISIGK------NCDKFGIVVHELGHVIGFWHEH 252

  Fly   693 ---DSDRQLLRACQSIQPPPVYS-------SSNSL--RLDFHTDAIRSDSSFQMHY--------- 736
               |.|..:....::|||...|:       ..|||  |.||  |:|       |||         
Human   253 TRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDF--DSI-------MHYARNTFSRGM 308

  Fly   737 ---EVVPGH-----------------------------PGCGGVYTESRGRIS------GYMNFE 763
               .::|..                             |.||....||.|.:|      ||.::.
Human   309 FLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPA
CGETLQESNGNLSSPGFPNGYPSYT 373

  Fly   764 VCLYLIEQPRGTQVKLVIDRVSLVQSLSCHYLKIEIFDGRSTDAPLLRRICGSHEESELEPIISI 828
            .|::.:....|.::.|....:.|.:|..|.|..||:.||....:|||.|.||   :...|.:.|.
Human   374 HCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCG---DKLPEVLTST 435

  Fly   829 GNVILVRYEYALSGVRLSKSFDLTYTRVCTGNFNTNSGIISTPNYPGPYFDDMTCTYNLTGPLDT 893
            .:.:.:  |:..|...:.|.|...|..:|.|....|.|.|.:||||..|.....|.:.:|  :..
Human   436 DSRMWI--EFRSSSNWVGKGFAAVY
EAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKIT--VSE 496

  Fly   894 AVRMRITDLSLGTANNENDT-SYLDVYLSADQ------------KRHIVKSTDNLILLSHSNRAS 945
            :..:.:|..|.....::|.. .||:|.....:            |...::||.|.:.:      .
Human   497 SYHVGLTFQSFEIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDKPEDIRSTSNTLWM------K 555

  Fly   946 LVFHGSGGGRGMRLEYNFVPNQCGGFLNEPGRRYVTAVRGTFCQWFIDFPGRKKISIHTLGPTPS 1010
            .|..|:....|....:....::|.    :|.|                 .|.::..::|||.   
Human   556 FVSDGTVNKAGFAANFFKEEDECA----KPDR-----------------GGCEQRCLNTLGS--- 596

  Fly  1011 ISIYDNSTSPGKLVNSYSGSVGDVFDGDLLTINLHTNWPRLEIYSIQFDIVQ-QDSCGGTFTARF 1074
               |..:..||                                |.:..|... :.:|||..|...
Human   597 ---YQCACEPG--------------------------------YELGPDRRSCEAACGGLLTKLN 626

  Fly  1075 GYIKSPNWPKNYGESQMCEWILRAPFGHRIELVVHNFTLEEEYSSTGCWTDWLEIRNGDSESSPL 1139
            |.|.:|.|||.|..::.|.|.:.||..:||.:....|.||   .:..|..|::||.:|.|..|.|
Human   627 GTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELE---GNEVCKYDYVEIWSGLSSESKL 688

  Fly  1140 IGRYCGNEIPSRIPSFGNVLHLKFKSDDSMEEKGFLLSW-------QQMGAGCGGKLSSSMGT-- 1195
            .|::||.|:|..|.|..|.:.::||||:::.:|||...:       .:...||..:..::||:  
Human   689 HGKFCGAEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYM 753

  Fly  1196 ------------------------IHSPHLLAGNRGILA-------------CDWQIIVAEGSRV 1223
                                    ||||      .|::.             |.|:|....|.|:
Human   754 CQCRNGFVLHDNKHDCKEAECEQKIHSP------SGLITSPNWPDKYPSRKECTWEISATPGHRI 812

  Fly  1224 SL---QLRSNDNRICS-GQLTLYDGPTTASNPIVIR-CNGTIAKPLQSTGNRVLVRYDVGHDAPD 1283
            .|   :.....::.|: ..|.::||.|..| ||:.| |...|..||.:|||::.||: |...:..
Human   813 KLAFSEFEIEQHQECAYDHLEVFDGETEKS-PILGRLCGNKIPDPLVATGNKMFVRF-VSDASVQ 875

  Fly  1284 GTDFMLNYQTNCRVRLEGLQGAIETP-------NFPENYPPGQ-DCEWDIRAGGRKNHLQLIFSH 1340
            ...|...:.|.|..||:    |...|       .|.:|..||| |||| :....|.:.|:|.|..
Human   876 RKGFQATHSTECGGRLK----AESKPRDLYSHAQFGDNNYPGQVDCEW-LLVSERGSRLELSFQT 935

  Fly  1341 LSVEKFSSICLNDYVSLVDMLDDQTLSEQHLCTNDGLEPITTVGNRLLLRFKSDSSVELQGFRAE 1405
            ..||: .:.|..|||.|.|.||...:.....|.:...|.|.::|:.:|:.|.:|.::..:||...
Human   936 FEVEE-EADCGYDYVELFDGLDSTAVGLGRFCGSGPPEEIYSIGDSVLIHFHTDDTINKKGFHIR 999

  Fly  1406 YKRI 1409
            ||.|
Human  1000 YKSI 1003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42255NP_729748.3 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:278437
EGF_CA 462..496 CDD:238011
CUB 503..619 CDD:238001 10/43 (23%)
CUB 624..738 CDD:238001 27/149 (18%)
CUB 745..854 CDD:238001 31/114 (27%)
CUB 857..963 CDD:238001 25/118 (21%)
CUB 1066..1179 CDD:238001 43/119 (36%)
CUB 1185..1293 CDD:238001 34/151 (23%)
CUB 1303..1406 CDD:238001 34/110 (31%)
CUB 1411..1523 CDD:238001
CUB 1530..1648 CDD:238001
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2096..2193 CDD:294042
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:294042
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:294042
CUB 3499..3607 CDD:238001
TLL1NP_036596.3 ZnMc_BMP1_TLD 148..347 CDD:239808 39/232 (17%)
Astacin 155..348 CDD:279708 39/233 (17%)
CUB 349..458 CDD:278839 31/113 (27%)
CUB 462..571 CDD:278839 25/116 (22%)
FXa_inhibition 582..614 CDD:291342 10/86 (12%)
CUB 618..727 CDD:278839 43/111 (39%)
FXa_inhibition 734..769 CDD:291342 4/34 (12%)
CUB 774..883 CDD:278839 31/116 (27%)
CUB 887..1000 CDD:278839 37/118 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.