DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42255 and CG34370

DIOPT Version :9

Sequence 1:NP_729748.3 Gene:CG42255 / 39334 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster
Sequence 2:NP_001097404.2 Gene:CG34370 / 5740565 FlyBaseID:FBgn0085399 Length:952 Species:Drosophila melanogaster


Alignment Length:1052 Identity:211/1052 - (20%)
Similarity:336/1052 - (31%) Gaps:404/1052 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 GYTGTTCSHQRFFCGVT------IRGP--SGQLHYPPNTADGDYQADERCPFIIRT----NRNMV 542
            |.:|::....|..|..|      |..|  |.|....|.|          |.:..||    .|:.|
  Fly    65 GGSGSSSDVSRDHCNKTVDIFEDISSPEVSNQNVGRPLT----------CWYRFRTLKGAPRDFV 119

  Fly   543 LNLTFTQF---QLEDSADCTADFLQLHDGNSLSS----RLIGRFCG-SRLPMT---NGSVITT-- 594
            |.|.|.:|   ||.::..|...:||:.|||:.:.    |..|.||| :..|.|   ..|.:..  
  Fly   120 LRLRFKKFKVGQLLNATHCEGGYLQIVDGNAKTDVSNRREPGMFCGEAEQPQTFISETSYVKVLF 184

  Fly   595 -----QEQVFFWF--RSDNQTQ---GKGFH----------VIWNSLPFSCGETINLTSTQTGVLR 639
                 .:|.:|.|  |::.||:   ..|.|          |:..|.   |.........||..::
  Fly   185 HTDNFTDQTYFTFDSRAEQQTEVYLRYGQHPELYPNRRGEVVQGSY---CEREYRDCRLQTCYVQ 246

  Fly   640 SPGYPGQARPELDCRWQLTAPFGYRLLLRFYDISLGSSEASAGNCSQDSLIVYDSDRQLLRACQS 704
            ||.|||.....|:||::|.....|   ::.|              .|:.....|..|     |::
  Fly   247 SPAYPGLYPRALNCRYKLHTRQPY---IKLY--------------LQNEQFAVDGQR-----CEN 289

  Fly   705 IQPPPVYSSSNSLRLDFHTDAIRSDSSFQMHYEVVPGHPGCGGVYTESRGRISGYMNFEVCLYLI 769
            :...|                ||...|...|                                  
  Fly   290 VMTCP----------------IRPIGSGNEH---------------------------------- 304

  Fly   770 EQPRGTQVKLVIDRVSLVQSLSCHYLKIEIFDGRSTDAPLLRRICGSHEESELEPIISIGNVILV 834
                                  |.|..:.::|||...:||:.:.||..:    .|...||....:
  Fly   305 ----------------------CPYDWLAVYDGRDEHSPLIGKFCGLGK----FPFSIIGTSQYM 343

  Fly   835 RYEYALS--GVRLSKSFDLTYTRVCTGNFNTNSGIISTPNYPGPYFDDMTCTYNLTGPLDTA-VR 896
            ..|:..|  |..|:..|          :||..       |:|              |.::|| ::
  Fly   344 YVEFVTSPAGPLLNTGF----------HFNVG-------NWP--------------GHVETAGIK 377

  Fly   897 MRITDLSLGTANNENDTSYLDVYLSADQKRHIVKSTDNLILLSH--SNRASLVFHGSGG-GRGMR 958
            ..:.|..|.:.:.::.::...::||                ::|  ....|..:|..|. |..:|
  Fly   378 HGVCDWLLSSDSLKDSSASEGIFLS----------------IAHWYPPNTSCSYHIKGHVGEIVR 426

  Fly   959 LEY-NFVPNQ-----------CGGFLN-------EPGRRYVTAVRGTFCQWFIDFPGRKKISIHT 1004
            |.: :|..|:           ||..|.       :|.|     :..|||..|    .|....:..
  Fly   427 LYFPSFRINRIESPILKYEGDCGESLTIYDSDHADPAR-----IIKTFCDTF----SRPMEKVDF 482

  Fly  1005 LGPTPSISI-YDNSTSPGKLVNSYSGSVGDVFDGDLLTINLHTNWPRLEIY-SIQF-DIVQQDSC 1066
            :..:||:.: :|:.|      .|||||            :|: .|...:.: :.:| |.|....|
  Fly   483 VSTSPSLYVQFDSKT------GSYSGS------------SLY-YWAHYDFFNNTRFGDPVPNTLC 528

  Fly  1067 GGTFTA---RFGYIKSP----NWPKNYGESQMCEWIL---RAPFGHRIELVVHNFTLEE-EYSST 1120
            .....|   ..|.::||    .:.:..|....|::..   |..:...| :.|::.:.:| .|:|.
  Fly   529 DEVMYAWKHPGGRLRSPLNSLIFKRTGGSDVRCQYKFVTDRRLYARAI-IEVNSVSFKELPYNSN 592

  Fly  1121 GC-------------WTDWLEIRNGDSESSPLIGRYCGNEIPS--RIPSFGNVLHLK-------- 1162
            .|             |.:..:.:|.       :..:|.| ||.  |:.|..:.::|:        
  Fly   593 ACTRCHEERVDKLVIWEERDKYQNN-------LACFCDN-IPRAVRVISSADQMNLEMIVQGQHA 649

  Fly  1163 ----FKSDDSMEEKGFLLSWQQMGAGCG----GKLSSSMGTIHSPH--LLAGNRGILA------- 1210
                ||:.:.:.|..:..:   .|..||    |  .|..|.:..|:  .||...|.:|       
  Fly   650 ITSYFKNPNPLFEATYEFA---HGPLCGPITLG--PSPDGELVFPYKKALAMVSGPMAPPEHHYR 709

  Fly  1211 ---CDWQIIVAEGSRVSLQL-------RSNDNR---------------ICSGQLTL-YDGP--TT 1247
               |.|::.||....:.|.|       ||.|:.               :|...::| .|.|  ||
  Fly   710 REKCIWELKVAAQRDLWLNLEKARFADRSCDSAKIEVYLAGRLEPRFVVCPENISLARDLPILTT 774

  Fly  1248 ASNPIVIRCNGTIAKPLQSTGNRVLVRYDVGHDAPDGTDFMLNY--------------------Q 1292
            |.    :...|...:||.     ||::| .|...|....|.|.:                    .
  Fly   775 AE----LGATGADQEPLP-----VLIQY-TGDGQPGRNIFRLVWTELFHLPRNPDGSLAASLLQD 829

  Fly  1293 TNCRVRLEG-----------LQGAIETPNFPENYPPGQ---DCEWDIRAGGRKNHL----QLIFS 1339
            ..|..|..|           ..|....||........|   ..||::...|..:|.    ||:..
  Fly   830 GGCDFRCPGDTEVCIPKHLLCNGIANCPNVTHTSTLSQLTRHIEWNLEQLGLLHHAGDYQQLVLH 894

  Fly  1340 HLSVEKFSSICL 1351
            ..|.|    |||
  Fly   895 DESPE----ICL 902

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42255NP_729748.3 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:278437
EGF_CA 462..496 CDD:238011 2/5 (40%)
CUB 503..619 CDD:238001 42/160 (26%)
CUB 624..738 CDD:238001 23/113 (20%)
CUB 745..854 CDD:238001 17/110 (15%)
CUB 857..963 CDD:238001 18/110 (16%)
CUB 1066..1179 CDD:238001 26/150 (17%)
CUB 1185..1293 CDD:238001 36/168 (21%)
CUB 1303..1406 CDD:238001 15/56 (27%)
CUB 1411..1523 CDD:238001
CUB 1530..1648 CDD:238001
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2096..2193 CDD:294042
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:294042
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:294042
CUB 3499..3607 CDD:238001
CG34370NP_001097404.2 CUB 88..195 CDD:238001 32/116 (28%)
CUB 244..363 CDD:238001 37/226 (16%)
CUB 407..509 CDD:238001 28/129 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.