DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42255 and bmp1a

DIOPT Version :9

Sequence 1:NP_729748.3 Gene:CG42255 / 39334 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster
Sequence 2:NP_001035126.1 Gene:bmp1a / 572452 ZFINID:ZDB-GENE-060818-1 Length:986 Species:Danio rerio


Alignment Length:833 Identity:199/833 - (23%)
Similarity:324/833 - (38%) Gaps:198/833 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   961 YNFVPNQCGGFLNEPGRRYVTAVRGTFCQWFIDFPGRKKISIHTLGPT-------------PSIS 1012
            :.:.|..|..::...|........|..|..|       .|.:|.||..             ..:|
Zfish   167 FTYRPCGCCSYVGRRGGGPQAISIGKNCDKF-------GIVVHELGHVIGFWHEHTRPDRDEHVS 224

  Fly  1013 IYDNSTSPGKLVNSYS------GSVGDVFDGDLLT----------INLHTNWPRLEIYSIQFDIV 1061
            |..::..||:..|...      .|:|:|:|.|.:.          |.|.|..||.::..::..|.
Zfish   225 IIRDNIQPGQEYNFLKMEPGEVDSLGEVYDFDSIMHYARNTFSRGIFLDTILPRYDVNGVRPPIG 289

  Fly  1062 QQ-----------------DSCGGTFTARFGYIKSPNWPKNYGESQMCEWILRAPFGHRIELVVH 1109
            |:                 ..||.:.....|...||.:|..|.....|.|.:....|.:|.|   
Zfish   290 QRTRLSKGDIAQARKLYKCPRCGDSLQESSGNFSSPGYPNGYSAYMHCIWRISVTPGEKIIL--- 351

  Fly  1110 NFTLEEEYSSTGCWTDWLEIRNGDSESSPLIGRYCGNEIPSRIPSFGNVLHLKFKSDDSMEEKGF 1174
            |||..:.|.|..||.|.:|||:|....:||.||:||:::|..|.|..:.|.::|:|..:...|||
Zfish   352 NFTSMDLYRSHLCWYDHVEIRDGYWRKAPLKGRFCGDKLPDPIISTDSRLWIEFRSSSNWVGKGF 416

  Fly  1175 LLSWQQMGAGCGGKLSSSMGTIHSPHLLAGNRGILACDWQIIVAEGSRVSLQLRS-----NDNRI 1234
            ...::   |.|||::....|.|.||:.....|....|.|:|.||:|..|.|..:|     :||  
Zfish   417 SAVYE---AICGGEVKKDNGQIQSPNYPDDYRPNKVCVWKITVAQGYHVGLTFQSFEIERHDN-- 476

  Fly  1235 CS-GQLTLYDGPTTASNPIVIRCNGTIAKP--LQSTGNRVLVRYDVGHDAPDGTDFMLNY----- 1291
            |: ..|.:.|| .:.|:|::.|..| ..||  ::|:.|::.::: |...:.:...|..|:     
Zfish   477 CAYDYLEVRDG-NSESSPLLGRFCG-YDKPDDIKSSSNQLWMKF-VSDGSVNKAGFAANFFKEMD 538

  Fly  1292 ----------------------------------QTNCRVRLEG----LQGAIETPNFPENYPPG 1318
                                              :.:|.....|    |.|:|.:|.:|:.|||.
Zfish   539 ECSRPDNGRCEQRCVNTLGSYKCACDPGYELAADKRSCEAACGGFITKLNGSITSPGWPKEYPPN 603

  Fly  1319 QDCEWDIRAGGRKNHLQLIFSHLSVE---------KFSSICLNDYVSLVDMLDDQTLSEQHLCTN 1374
            ::|.|.:.| ..:..:.|:|.....|         ....:|..|:|.:...|...:......|..
Zfish   604 KNCIWQLVA-PTQYRITLLFDVFETEGNDVSTRFLPLRGVCKYDFVEVRSGLSADSRLHGKFCGA 667

  Fly  1375 DGLEPITTVGNRLLLRFKSDSSVELQGFRAEY--------------------------------- 1406
            :..|.||:..|.:.:.||||::|..:||:|::                                 
Zfish   668 EKPEAITSQYNNMRIEFKSDNTVSKKGFKAQFFSDKDECSKENGGCQHECVNTFGSYSCQCRSGF 732

  Fly  1407 ---------KRIGCGEHLRESGGRFESPNAP--FSVDMDCVWIITASEGNQIRLLLHEVYFEAPQ 1460
                     |..||...:....|...|||.|  :.....|.|.::.:.|::|::..:|:..| |.
Zfish   733 VLHENKHDCKEAGCDHVVNSVSGTITSPNWPDKYPSKKACTWALSTTPGHRIKIAFNEIDME-PH 796

  Fly  1461 IECR-------DAESSLSVSAPSGYNSSVVLFRSCHEETQTQTFTSPGNELVIRFVSSSAPSRKY 1518
            :||.       |...|.:.|          |.|.|..: :.|...|.||::.|||.|.::..:|.
Zfish   797 LECAYDHIEIYDGRDSKAQS----------LGRYCGTK-KPQPIISTGNKMFIRFFSDNSVQKKG 850

  Fly  1519 FKASFVQVPASCGGYISASSGVLTTPGFHNH-QDSKNVANYTSNIECVWTVEVTNGYGIRPHFEQ 1582
            |:||..   |.|||.:.|.   :.|...::| |...|  ||....:|.|.:....|||:...|:.
Zfish   851 FEASHT---AECGGRLKAE---VKTKDLYSHAQFGDN--NYPGASDCQWVITAEKGYGVELIFQT 907

  Fly  1583 FNLTDSGNCSVSFVELTKLEPDNKEIFLEKTCGEDSPMIRIVHGRKLRVRFKS 1635
            |.:.:..:|...::||.. ..|.|...|.:.||...|......|..:.::|.|
Zfish   908 FEIEEEADCGYDYMELFD-GADTKSPRLGRYCGSGPPEEIYSAGDSIVIKFHS 959

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42255NP_729748.3 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:278437
EGF_CA 462..496 CDD:238011
CUB 503..619 CDD:238001
CUB 624..738 CDD:238001
CUB 745..854 CDD:238001
CUB 857..963 CDD:238001 0/1 (0%)
CUB 1066..1179 CDD:238001 39/112 (35%)
CUB 1185..1293 CDD:238001 34/154 (22%)
CUB 1303..1406 CDD:238001 30/111 (27%)
CUB 1411..1523 CDD:238001 32/120 (27%)
CUB 1530..1648 CDD:238001 29/107 (27%)
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2096..2193 CDD:294042
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:294042
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:294042
CUB 3499..3607 CDD:238001
bmp1aNP_001035126.1 ZnMc_BMP1_TLD 112..309 CDD:239808 27/148 (18%)
Astacin 117..309 CDD:279708 27/148 (18%)
CUB 311..420 CDD:278839 39/111 (35%)
CUB 424..533 CDD:278839 33/113 (29%)
FXa_inhibition 544..576 CDD:291342 0/31 (0%)
CUB 580..699 CDD:278839 32/119 (27%)
FXa_inhibition 706..741 CDD:291342 0/34 (0%)
CUB 746..855 CDD:278839 32/120 (27%)
CUB 859..972 CDD:278839 29/107 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.