DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42255 and mep1a.2

DIOPT Version :9

Sequence 1:	NP_729748.3	Gene:	CG42255 / 39334	FlyBaseID:	FBgn0259140	Length:	3613	Species:	Drosophila melanogaster
Sequence 2:	NP_001122199.1	Gene:	mep1a.2 / 565535	ZFINID:	ZDB-GENE-041001-208	Length:	689	Species:	Danio rerio

Alignment Length:	59	Identity:	25/59 - (42%)
Similarity:	27/59 - (45%)	Gaps:	8/59 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   461 SDACHPSPCLNGGTCRLLPDAKYQCVCPRG----YTGTTCSHQRF---FCGVTIRGPSG 512
            ||.|.|:||.|||.| :....|..|.|..|    |||.||..|..   ..||.|.|..|
Zfish   616 SDLCQPNPCQNGGAC-VTHQGKATCRCASGQAVVYTGDTCEKQHIDGGIMGVLIGGAVG 673

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42255	NP_729748.3	EGF_CA	156..190	CDD:238011
		EGF_CA	192..233	CDD:238011
		EGF_CA	290..328	CDD:214542
		EGF_CA	330..374	CDD:214542
		EGF	427..455	CDD:278437
		EGF_CA	462..496	CDD:238011	16/37 (43%)
		CUB	503..619	CDD:238001	5/10 (50%)
		CUB	624..738	CDD:238001
		CUB	745..854	CDD:238001
		CUB	857..963	CDD:238001
		CUB	1066..1179	CDD:238001
		CUB	1185..1293	CDD:238001
		CUB	1303..1406	CDD:238001
		CUB	1411..1523	CDD:238001
		CUB	1530..1648	CDD:238001
		CUB	1754..1862	CDD:238001
		CUB	1979..2091	CDD:238001
		CUB	2096..2193	CDD:294042
		CUB	2210..2321	CDD:238001
		CUB	2327..2441	CDD:238001
		CUB	2688..2782	CDD:294042
		CUB	2810..2911	CDD:238001
		CUB	3029..3143	CDD:238001
		CUB	3169..3249	CDD:294042
		CUB	3499..3607	CDD:238001
mep1a.2	NP_001122199.1	ZnMc	26..254	CDD:294052
		Astacin	68..256	CDD:279708
		MAM	259..423	CDD:214533
		MAM	264..423	CDD:99706
		MATH	423..579	CDD:295307
		EGF	619..653	CDD:278437	15/34 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3714
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900