DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cubn2 and CG10280

DIOPT Version :10

Sequence 1:NP_729748.3 Gene:Cubn2 / 39334 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster
Sequence 2:NP_001246942.1 Gene:CG10280 / 40740 FlyBaseID:FBgn0037395 Length:362 Species:Drosophila melanogaster


Alignment Length:199 Identity:40/199 - (20%)
Similarity:67/199 - (33%) Gaps:55/199 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1276 DVGHDAPDGT------DFMLNYQTNCRVRLEGLQGAIETPNFPENYPPGQDCEWDIRAGGRKNHL 1334
            |:|.|.|:..      |..::..|...:||     .:.....|:...|.....::|.........
  Fly   108 DLGIDDPETMPRLFQGDIAIDPYTYITLRL-----GVNPMRHPKRLWPNGTIPFEISPRYANQER 167

  Fly  1335 QLIFSHLSVEKFSSICLNDYVSLVDMLDDQTLSEQHLCTNDGLEPITTVGNRLLLRFKSDSSVEL 1399
            |.|..  :|:.|:|:....:|.....:||..|          :||                  .|
  Fly   168 QAIIQ--AVKTFNSLTCVHFVPYDGEVDDYLL----------IEP------------------PL 202

  Fly  1400 QGFRAEYKRIGCGEHL-RESGGRFESPNAPFSVDMDCVWIITASEGNQIRLLLHE--VYFEAPQI 1461
            :|.:      ||..:: |..|.:..|...|......|.    :|||..:..|:|.  :|.|..:.
  Fly   203 EGPQ------GCWSYVGRRGGEQVVSLQRPDENSAHCF----SSEGRIMHELMHAIGIYHEQSRA 257

  Fly  1462 ECRD 1465
            : ||
  Fly   258 D-RD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cubn2NP_729748.3 cubilin_NTD 38..141 CDD:412063
EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:394967
EGF_CA 462..496 CDD:238011
CUB 503..619 CDD:238001
CUB 624..738 CDD:238001
CUB 745..854 CDD:238001
CUB 857..963 CDD:238001
CUB 1066..1179 CDD:238001
CUB 1185..1293 CDD:238001 5/22 (23%)
CUB 1303..1406 CDD:238001 16/102 (16%)
CUB 1411..1523 CDD:238001 15/58 (26%)
CUB 1530..1648 CDD:238001
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:412131
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:412131
CUB 3499..3607 CDD:238001
CG10280NP_001246942.1 ZnMc_astacin_like 151..342 CDD:239807 30/151 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.