Sequence 1: | NP_729748.3 | Gene: | CG42255 / 39334 | FlyBaseID: | FBgn0259140 | Length: | 3613 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_609759.1 | Gene: | CG11865 / 34917 | FlyBaseID: | FBgn0028947 | Length: | 240 | Species: | Drosophila melanogaster |
Alignment Length: | 258 | Identity: | 48/258 - (18%) |
---|---|---|---|
Similarity: | 86/258 - (33%) | Gaps: | 96/258 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 921 SADQKRHIVKSTDNLILLSHSNRASLVFHGSGGGR-----------GMRLEYNFVPNQCGGFLN- 973
Fly 974 ---------------------------EPGRRYVTAVRGTFCQWFIDFPGRKKISIHTLGPTPSI 1011
Fly 1012 SIYDNSTSPGKLVNSYSGSVGDVFDGDLLTINLHTNWPRLEIYSIQFDIVQQDSCGGTFTARFGY 1076
Fly 1077 IKSPNWPKNYGESQMCEWILRAPFGHRIELVVHNFTLEEEYSSTGCWTDWLEIRNGDSESSPL 1139 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42255 | NP_729748.3 | EGF_CA | 156..190 | CDD:238011 | |
EGF_CA | 192..233 | CDD:238011 | |||
EGF_CA | 290..328 | CDD:214542 | |||
EGF_CA | 330..374 | CDD:214542 | |||
EGF | 427..455 | CDD:278437 | |||
EGF_CA | 462..496 | CDD:238011 | |||
CUB | 503..619 | CDD:238001 | |||
CUB | 624..738 | CDD:238001 | |||
CUB | 745..854 | CDD:238001 | |||
CUB | 857..963 | CDD:238001 | 14/52 (27%) | ||
CUB | 1066..1179 | CDD:238001 | 13/74 (18%) | ||
CUB | 1185..1293 | CDD:238001 | |||
CUB | 1303..1406 | CDD:238001 | |||
CUB | 1411..1523 | CDD:238001 | |||
CUB | 1530..1648 | CDD:238001 | |||
CUB | 1754..1862 | CDD:238001 | |||
CUB | 1979..2091 | CDD:238001 | |||
CUB | 2096..2193 | CDD:294042 | |||
CUB | 2210..2321 | CDD:238001 | |||
CUB | 2327..2441 | CDD:238001 | |||
CUB | 2688..2782 | CDD:294042 | |||
CUB | 2810..2911 | CDD:238001 | |||
CUB | 3029..3143 | CDD:238001 | |||
CUB | 3169..3249 | CDD:294042 | |||
CUB | 3499..3607 | CDD:238001 | |||
CG11865 | NP_609759.1 | Astacin | 56..239 | CDD:279708 | 37/214 (17%) |
ZnMc_astacin_like | 58..239 | CDD:239807 | 37/212 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45444808 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |