DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cubn2 and LOC3291156

DIOPT Version :10

Sequence 1:NP_729748.3 Gene:Cubn2 / 39334 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster
Sequence 2:XP_061515401.1 Gene:LOC3291156 / 3291156 VectorBaseID:AGAMI1_011545 Length:276 Species:Anopheles gambiae


Alignment Length:193 Identity:48/193 - (24%)
Similarity:74/193 - (38%) Gaps:56/193 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   767 YLIEQPRGTQVKLVIDR----VSLVQSLSCHYLKIEIFDGRSTDAPLLRRICGSH---------- 817
            |.|.:|..||.:  ||.    |.|:||.||  |:   |...|:|||...|:.||.          
Mosquito    89 YYIHEPDFTQAQ--IDHIELGVRLLQSQSC--LR---FHRVSSDAPAYIRVIGSDSGCYSSVGYT 146

  Fly   818 ---EESELEPII------SIGNVI-----LVRYEYALSGVRLSKSFDLTYTRVCTG---NFNT-N 864
               :...|.|.:      .||.|:     .:.:.:..|.....:..|:.:..:.||   |||. |
Mosquito   147 GRAQNLNLAPSVPGQGCFRIGTVVHEFLHALGFYHQQSASDRDEFVDIIWENIQTGTENNFNIYN 211

  Fly   865 SGIISTPNYPGPYFDDM---TCTYNLTG-----PLD--TAVRMRITDLSLGTANNENDTSYLD 917
            |.:::..|....|...|   ...:::.|     |.|  ..:..||       :.:|.|.|.|:
Mosquito   212 SSVVTDFNVQYDYGSVMHYGATAFSVNGQRTIIPKDPNATIGQRI-------SMSERDISKLN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cubn2NP_729748.3 cubilin_NTD 38..141 CDD:412063
EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:394967
EGF_CA 462..496 CDD:238011
CUB 503..619 CDD:238001
CUB 624..738 CDD:238001
CUB 745..854 CDD:238001 29/114 (25%)
CUB 857..963 CDD:238001 19/75 (25%)
CUB 1066..1179 CDD:238001
CUB 1185..1293 CDD:238001
CUB 1303..1406 CDD:238001
CUB 1411..1523 CDD:238001
CUB 1530..1648 CDD:238001
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:412131
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:412131
CUB 3499..3607 CDD:238001
LOC3291156XP_061515401.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.