DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42255 and LRP12

DIOPT Version :9

Sequence 1:NP_729748.3 Gene:CG42255 / 39334 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster
Sequence 2:NP_038465.1 Gene:LRP12 / 29967 HGNCID:31708 Length:859 Species:Homo sapiens


Alignment Length:420 Identity:100/420 - (23%)
Similarity:156/420 - (37%) Gaps:120/420 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1065 SCGGT---FTARFGYIKSPNWPKNYGESQMCEWILRAPFGHRIELVVHNFTLEEEYSSTGCWTDW 1126
            :||.|   ..|..|.|.||.||..|.....|.|.:||..|..|.:...:|.::   .|..|..||
Human    46 ACGETPEQIRAPSGIITSPGWPSEYPAKINCSWFIRANPGEIITISFQDFDIQ---GSRRCNLDW 107

  Fly  1127 LEI---RNGDSESSPLIGRYCGNEIPSRIPSFGNVLHLKFKSDDSMEEKGFLLSWQQMGAGCGGK 1188
            |.|   :|.:|.      |.||:.||....|..:.:.::|.|||::..|||             :
Human   108 LTIETYKNIESY------RACGSTIPPPYISSQDHIWIRFHSDDNISRKGF-------------R 153

  Fly  1189 LSSSMGTIHSPHLLAGNRGILACDWQIIVAEGSRVSLQLR---------SNDNRICSGQLTLYDG 1244
            |:...|....|:        .||| |.....|..:....:         |:|..||:.:.   :.
Human   154 LAYFSGKSEEPN--------CACD-QFRCGNGKCIPEAWKCNNMDECGDSSDEEICAKEA---NP 206

  Fly  1245 PTTAS---------------------NPIVIRCNGTIAKPLQSTGNRVLVRYDVGHDAPDGTDFM 1288
            ||.|:                     .|..::|:|.|  .....|:      ::..|.|      
Human   207 PTAAAFQPCAYNQFQCLSRFTKVYTCLPESLKCDGNI--DCLDLGD------EIDCDVP------ 257

  Fly  1289 LNYQTNCRVRLEGLQGAIETPNFPENYPPGQDCEWDIRAGGRKNHLQLIFSHLSVEKFSSICLN- 1352
                 .|...|:...|...:||:|:.||||.:|.|.|..|   :|.::|.      :|:...|: 
Human   258 -----TCGQWLKYFYGTFNSPNYPDFYPPGSNCTWLIDTG---DHRKVIL------RFTDFKLDG 308

  Fly  1353 ----DYVSLVDMLDDQTLSEQHLCTN-DGLEPITTVGN--RLLLRFKSDSSVELQGFRAEYK--- 1407
                |||.:.|.|::.......:.|. |...|:|.|.:  ::.:.|.:|.....:||.|.|:   
Human   309 TGYGDYVKIYDGLEENPHKLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVNAARGFNATYQVDG 373

  Fly  1408 -----------RIGCGEHLRESGGRFESPN 1426
                       ..||....:...|.:..||
Human   374 FCLPWEIPCGGNWGCYTEQQRCDGYWHCPN 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42255NP_729748.3 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:278437
EGF_CA 462..496 CDD:238011
CUB 503..619 CDD:238001
CUB 624..738 CDD:238001
CUB 745..854 CDD:238001
CUB 857..963 CDD:238001
CUB 1066..1179 CDD:238001 39/118 (33%)
CUB 1185..1293 CDD:238001 22/137 (16%)
CUB 1303..1406 CDD:238001 31/110 (28%)
CUB 1411..1523 CDD:238001 4/16 (25%)
CUB 1530..1648 CDD:238001
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2096..2193 CDD:294042
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:294042
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:294042
CUB 3499..3607 CDD:238001
LRP12NP_038465.1 CUB 47..158 CDD:238001 40/132 (30%)
LDLa 166..200 CDD:238060 7/34 (21%)
LDLa 215..254 CDD:238060 5/46 (11%)
CUB 267..371 CDD:238001 32/112 (29%)
LDLa 375..410 CDD:238060 5/29 (17%)
LDLa 413..448 CDD:238060
LDLa 451..485 CDD:238060
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..678
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 693..723
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 748..770
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 801..823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.