DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42255 and Mfrp

DIOPT Version :9

Sequence 1:NP_729748.3 Gene:CG42255 / 39334 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster
Sequence 2:NP_667337.1 Gene:Mfrp / 259172 MGIID:2385957 Length:584 Species:Mus musculus


Alignment Length:500 Identity:115/500 - (23%)
Similarity:171/500 - (34%) Gaps:128/500 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1238 QLTLYDGPTTASNPIVIR-------CNGTIAKPLQSTGNRVLVRYDVGHDAPDGTDFMLNYQTNC 1295
            ||.....|.|..||::.|       ...|......:|......|......|...|     :||.|
Mouse    91 QLQATSLPRTTKNPLLTRGLTPMGVIPSTTPNTTTTTTTTTPARTGQQEAAMSPT-----HQTTC 150

  Fly  1296 RVRLEGLQGAIETPNFPENYPPGQDCEWDIR-AGGRKNHLQLIFSHLSVEKFSSICLNDYVSLVD 1359
            ...|.|..|...:||:|:.|||...|.|.|: |.|:.  :||....||:|...: ||.|   .::
Mouse   151 GGLLPGPSGFFSSPNYPDLYPPLSHCVWHIQVAAGQT--IQLKIQALSIESMLT-CLFD---RLE 209

  Fly  1360 MLDDQTLSEQHLCTNDGLEPITTVGNRLLLRFKSDSSVELQGFRAEYKRIGCGEHLRESGGRFES 1424
            ::.:.|.....:|.......:.|..:.|.:.|.||:.||..||:|.|:.:        :.|.:..
Mouse   210 IISEPTGPLLRVCGKTPPATLNTNTSHLRVSFVSDNDVEGSGFQAWYQAV--------APGHWSC 266

  Fly  1425 PNAPFSVD-MDCVWIITASEGNQIRLLLHEVYFEAPQIECRDAESSLSVSAPSGYNSSVVLFRSC 1488
            .:..|..| :.|:...:..:|               ..||.|.....:.||.:            
Mouse   267 AHNEFHCDLLLCLKRDSVCDG---------------ITECADGSDEANCSAKT------------ 304

  Fly  1489 HEETQTQTFTSPGNELVIRFVSSSAPSRKYFKASFVQVPASCGGYISASSGVLTTPGFHNHQDSK 1553
                                                   ..|||.::...||.:||.:..|    
Mouse   305 ---------------------------------------LGCGGNLTGLYGVFSTPNYPQH---- 326

  Fly  1554 NVANYTSNIECVWTVEVTNGYGIRPHFEQFNLTDSGNCSVSFVELTKLEPDNKEIFLEKTCGEDS 1618
                |.....|.|.:||..|||||..|..|:|.....|...:||:.:........||.:.||.:.
Mouse   327 ----YPHQQLCTWYIEVPVGYGIRLEFHNFSLEAQAECKFDYVEVYEASNLGTFSFLGRFCGAEP 387

  Fly  1619 PMIRIVHGRKLRVRFKSQAGTWGRFIMYFERQCGGRLSTGEGYLQSRLDEECSWLVTSPEGSKLS 1683
            |:..:....:|.|.||:..|.          ..||.|:|.:..  :..:..|.|......|....
Mouse   388 PLNVVSSMHQLAVIFKTDLGI----------SSGGFLATYQAI--NTTESGCPWAEFCQSGGYRD 440

  Fly  1684 LIINQLEC---PKC-NAVSQNCSEGL----QLLNDDDQVLLYQMC 1720
            |   |..|   ..| |..:.|||..|    .|..:..||   :||
Mouse   441 L---QWMCDLWKDCANDSNDNCSSHLSPQPDLTCEPVQV---EMC 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42255NP_729748.3 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:278437
EGF_CA 462..496 CDD:238011
CUB 503..619 CDD:238001
CUB 624..738 CDD:238001
CUB 745..854 CDD:238001
CUB 857..963 CDD:238001
CUB 1066..1179 CDD:238001
CUB 1185..1293 CDD:238001 12/61 (20%)
CUB 1303..1406 CDD:238001 32/103 (31%)
CUB 1411..1523 CDD:238001 10/112 (9%)
CUB 1530..1648 CDD:238001 34/117 (29%)
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2096..2193 CDD:294042
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:294042
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:294042
CUB 3499..3607 CDD:238001
MfrpNP_667337.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..140 4/31 (13%)
CUB 150..258 CDD:238001 36/113 (32%)
LDLa 266..300 CDD:238060 7/48 (15%)
CUB 307..419 CDD:238001 38/129 (29%)
Fz 471..573 CDD:279700 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4292
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.