| Sequence 1: | NP_729748.3 | Gene: | CG42255 / 39334 | FlyBaseID: | FBgn0259140 | Length: | 3613 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_037315.1 | Gene: | Mep1b / 25727 | RGDID: | 3081 | Length: | 704 | Species: | Rattus norvegicus |
| Alignment Length: | 199 | Identity: | 47/199 - (23%) |
|---|---|---|---|
| Similarity: | 80/199 - (40%) | Gaps: | 50/199 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 23 TSRDNLEKRAHLVRQSNDNLLLEPA-WDRNVSLRLMGESATVTINDVDMMTVLRRRQRIIADRQA 86
Fly 87 ARREPLKVDAVRDMFHDVELKMTRIQRRIFSARNSTKRS-----GLNQRILRRQLQRVERVKG-- 144
Fly 145 --ILQTL-----------------AGNLARNECLSNPCKNGGTCHDAYKGFQCECPAG----WQG 186
Fly 187 DSCE 190 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42255 | NP_729748.3 | EGF_CA | 156..190 | CDD:238011 | 13/37 (35%) |
| EGF_CA | 192..233 | CDD:238011 | |||
| EGF_CA | 290..328 | CDD:214542 | |||
| EGF_CA | 330..374 | CDD:214542 | |||
| EGF | 427..455 | CDD:278437 | |||
| EGF_CA | 462..496 | CDD:238011 | |||
| CUB | 503..619 | CDD:238001 | |||
| CUB | 624..738 | CDD:238001 | |||
| CUB | 745..854 | CDD:238001 | |||
| CUB | 857..963 | CDD:238001 | |||
| CUB | 1066..1179 | CDD:238001 | |||
| CUB | 1185..1293 | CDD:238001 | |||
| CUB | 1303..1406 | CDD:238001 | |||
| CUB | 1411..1523 | CDD:238001 | |||
| CUB | 1530..1648 | CDD:238001 | |||
| CUB | 1754..1862 | CDD:238001 | |||
| CUB | 1979..2091 | CDD:238001 | |||
| CUB | 2096..2193 | CDD:294042 | |||
| CUB | 2210..2321 | CDD:238001 | |||
| CUB | 2327..2441 | CDD:238001 | |||
| CUB | 2688..2782 | CDD:294042 | |||
| CUB | 2810..2911 | CDD:238001 | |||
| CUB | 3029..3143 | CDD:238001 | |||
| CUB | 3169..3249 | CDD:294042 | |||
| CUB | 3499..3607 | CDD:238001 | |||
| Mep1b | NP_037315.1 | ZnMc | 30..256 | CDD:294052 | |
| Astacin | 70..258 | CDD:279708 | |||
| MAM | 266..430 | CDD:279023 | |||
| MAM | 266..428 | CDD:99706 | |||
| MATH | 428..586 | CDD:295307 | 32/136 (24%) | ||
| EGF_CA | 609..647 | CDD:238011 | 13/37 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||