DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cubn2 and nas-18

DIOPT Version :10

Sequence 1:NP_729748.3 Gene:Cubn2 / 39334 FlyBaseID:FBgn0259140 Length:3613 Species:Drosophila melanogaster
Sequence 2:NP_001309451.1 Gene:nas-18 / 186924 WormBaseID:WBGene00003537 Length:240 Species:Caenorhabditis elegans


Alignment Length:47 Identity:17/47 - (36%)
Similarity:23/47 - (48%) Gaps:5/47 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 YSGVVCNSSDACH-PSP--CLNGGTCRLLPDAKYQCVCPRGYTGTTC 496
            |..|:.|::..|. |:.  |.|||...  |....:|:||.||.|..|
 Worm   143 YDMVILNTAYNCKCPNELLCGNGGYTN--PSKCSECICPLGYGGVLC 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cubn2NP_729748.3 cubilin_NTD 38..141 CDD:412063
EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 290..328 CDD:214542
EGF_CA 330..374 CDD:214542
EGF 427..455 CDD:394967 1/1 (100%)
EGF_CA 462..496 CDD:238011 13/36 (36%)
CUB 503..619 CDD:238001
CUB 624..738 CDD:238001
CUB 745..854 CDD:238001
CUB 857..963 CDD:238001
CUB 1066..1179 CDD:238001
CUB 1185..1293 CDD:238001
CUB 1303..1406 CDD:238001
CUB 1411..1523 CDD:238001
CUB 1530..1648 CDD:238001
CUB 1754..1862 CDD:238001
CUB 1979..2091 CDD:238001
CUB 2210..2321 CDD:238001
CUB 2327..2441 CDD:238001
CUB 2688..2782 CDD:412131
CUB 2810..2911 CDD:238001
CUB 3029..3143 CDD:238001
CUB 3169..3249 CDD:412131
CUB 3499..3607 CDD:238001
nas-18NP_001309451.1 Astacin 1..156 CDD:426242 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.