Sequence 1: | NP_729748.3 | Gene: | CG42255 / 39334 | FlyBaseID: | FBgn0259140 | Length: | 3613 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_495552.2 | Gene: | nas-7 / 182368 | WormBaseID: | WBGene00003526 | Length: | 382 | Species: | Caenorhabditis elegans |
Alignment Length: | 257 | Identity: | 56/257 - (21%) |
---|---|---|---|
Similarity: | 88/257 - (34%) | Gaps: | 99/257 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 2578 TVCPPNIGDQATGSISIQSLLQVPGYHCTIKFVGTDSATLTFKVEEYLFQTAGGPAVVFRDDIT- 2641
Fly 2642 ------NIPVKAMYANVTNSFVSVVTSAGSVTLLNSKNVKLRRFRATYRRHNCGGRLQAAE---G 2697
Fly 2698 VTIE-------SPD---LLTTLNDAYGEVECLWTLSNSNG---YVLEGNVTLTDRCDREYIVIFS 2749
Fly 2750 GQSEVGRI--CRGMAMNSTLLERPFSTIL---------YHSESRLAQQSKFILQAWKSVSSG 2800 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42255 | NP_729748.3 | EGF_CA | 156..190 | CDD:238011 | |
EGF_CA | 192..233 | CDD:238011 | |||
EGF_CA | 290..328 | CDD:214542 | |||
EGF_CA | 330..374 | CDD:214542 | |||
EGF | 427..455 | CDD:278437 | |||
EGF_CA | 462..496 | CDD:238011 | |||
CUB | 503..619 | CDD:238001 | |||
CUB | 624..738 | CDD:238001 | |||
CUB | 745..854 | CDD:238001 | |||
CUB | 857..963 | CDD:238001 | |||
CUB | 1066..1179 | CDD:238001 | |||
CUB | 1185..1293 | CDD:238001 | |||
CUB | 1303..1406 | CDD:238001 | |||
CUB | 1411..1523 | CDD:238001 | |||
CUB | 1530..1648 | CDD:238001 | |||
CUB | 1754..1862 | CDD:238001 | |||
CUB | 1979..2091 | CDD:238001 | |||
CUB | 2096..2193 | CDD:294042 | |||
CUB | 2210..2321 | CDD:238001 | |||
CUB | 2327..2441 | CDD:238001 | |||
CUB | 2688..2782 | CDD:294042 | 27/120 (23%) | ||
CUB | 2810..2911 | CDD:238001 | |||
CUB | 3029..3143 | CDD:238001 | |||
CUB | 3169..3249 | CDD:294042 | |||
CUB | 3499..3607 | CDD:238001 | |||
nas-7 | NP_495552.2 | Astacin | 87..274 | CDD:279708 | 29/132 (22%) |
ZnMc_astacin_like | 91..270 | CDD:239807 | 29/128 (23%) | ||
ShK | 347..382 | CDD:279838 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |