DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10361 and Alas

DIOPT Version :9

Sequence 1:NP_648509.1 Gene:CG10361 / 39333 FlyBaseID:FBgn0036208 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_477281.1 Gene:Alas / 37815 FlyBaseID:FBgn0020764 Length:539 Species:Drosophila melanogaster


Alignment Length:340 Identity:116/340 - (34%)
Similarity:194/340 - (57%) Gaps:7/340 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SDKKILNFCANNYLGLANNPEIVEHSQKLLEQYGAGLSSVRFICGTQDIHKQLEKKIAQFHGRED 126
            ::|.|..:|:|:|||::.:|.:....|..|.::|:|....|.|.|....|::||.|:|:.|.:|.
  Fly   137 TEKPITVWCSNDYLGMSAHPGVKRAVQDALNRHGSGAGGTRNISGNSLHHERLESKLAELHQKEA 201

  Fly   127 TILYASCFDAN-AGIFE-AILTPEDAVFSDELNHASIIDGIRLCKAKKQRYRHRDLGDLEEQLKA 189
            .:|:.|||.|| :.:|. |.|.|...:|||..||||:|.|||.....|..:||.|:..|.:.||.
  Fly   202 ALLFTSCFVANDSTLFTLAKLLPGCEIFSDAGNHASMIMGIRNSGVPKHIFRHNDVDHLHQLLKQ 266

  Fly   190 SDARL-KLIATDGVFSMDGNIAPLARIVELARKYNALVFVDECHATGFFGATGRGTEEYDNVMGE 253
            :|..: |::|.:.|.||.|.|.||..::::|.::.|:.|:||.||.|.:|..|.|..|.|.|:.:
  Fly   267 TDKSVPKIVAFETVHSMTGAICPLEELLDVAHEHGAITFIDEVHAVGLYGDHGAGVGERDGVLHK 331

  Fly   254 VDIINSTLGKALGGASGGYTTGPAELISFLRQKSRPYLFSNTLPPAVVAVGLKVMDMLL--QSSE 316
            :|||:.|||||.|.. |||..|...|:..:|..:..::|:.:|||.|:...|:.:::|.  :..:
  Fly   332 MDIISGTLGKAFGNI-GGYIAGTHNLVDMIRSYAAGFIFTTSLPPTVLCGALEAVNILASEEGRQ 395

  Fly   317 LTQRVQSNTQRFRQAMTKAGFTIAGENHPICPVMLGDARLASQFADEMLTR-GIYVIGFSYPVVP 380
            |....|.|....:..:.:.||.:......|.|:.:||...:||.::.::.: |.|:...:||.|.
  Fly   396 LRHLHQRNVSYLKSLLKREGFPVEETPSHIIPIKIGDPLKSSQISNVLIEQFGHYLQSINYPTVA 460

  Fly   381 QGKARIRVQISAAHT 395
            :|:.::|:..:..||
  Fly   461 RGQEKLRLAPTPFHT 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10361NP_648509.1 PRK06939 19..416 CDD:235893 116/340 (34%)
BioF 30..410 CDD:223234 116/340 (34%)
AlasNP_477281.1 AAT_I 93..495 CDD:302748 116/340 (34%)
BioF 95..490 CDD:223234 116/340 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453116
Domainoid 1 1.000 175 1.000 Domainoid score I1100
eggNOG 1 0.900 - - E1_COG0156
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D63467at33392
OrthoFinder 1 1.000 - - FOG0000902
OrthoInspector 1 1.000 - - otm2603
orthoMCL 1 0.900 - - OOG6_100359
Panther 1 1.100 - - P PTHR13693
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R554
SonicParanoid 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.