DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gcat and Sptlc1

DIOPT Version :10

Sequence 1:NP_648509.1 Gene:Gcat / 39333 FlyBaseID:FBgn0036208 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_033295.2 Gene:Sptlc1 / 268656 MGIID:1099431 Length:473 Species:Mus musculus


Alignment Length:171 Identity:33/171 - (19%)
Similarity:48/171 - (28%) Gaps:62/171 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PKRLEKYLKKQGFSGNSYRILMGDMRESNQMDQVAHSLPLPLDADFLPRMMPFLHHTVLKHGKKC 98
            |.||.|..||....|                  |.|...|||:                      
Mouse  1612 PTRLGKQFKKLDKLG------------------VTHEEHLPLN---------------------- 1636

  Fly    99 FTWYGPYPNVIVMDPETLREIMSKHELFPKP-KIGSHNHVFLSGLLNHEGPKWSKHRSILNPAFR 162
                |...|...:...|....|:.|.|..|. .:...|.:         |||.:..::.|.....
Mouse  1637 ----GTEDNGPTIGTTTAHSYMTDHNLNSKECSVKGPNCI---------GPKSNIDKARLEQESS 1688

  Fly   163 IDNLKSILPAFNSSCKEMLEEWERLASAKGTMELDSWTHCH 203
            :|| ..:..:..|.|::.|.:.|.|       .:..|...|
Mouse  1689 VDN-GEVKESVESPCEQTLSDEEEL-------WMGPWNSLH 1721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GcatNP_648509.1 PRK06939 19..416 CDD:235893 33/171 (19%)
Sptlc1NP_033295.2 Interaction with SPTLC2. /evidence=ECO:0000250|UniProtKB:O15269 1..66
AAT_I 11..472 CDD:450240
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.