DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp68D and KIFC1

DIOPT Version :9

Sequence 1:NP_001261726.1 Gene:Klp68D / 39332 FlyBaseID:FBgn0004381 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_016866325.1 Gene:KIFC1 / 3833 HGNCID:6389 Length:674 Species:Homo sapiens


Alignment Length:301 Identity:120/301 - (39%)
Similarity:172/301 - (57%) Gaps:30/301 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RKVFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGND-ELMG 127
            |..|::|..:...:.|..::.|:.. ||.|.|:|:..|||||||||:||||||||..|.| :|.|
Human   369 RHDFSFDRVFPPGSGQDEVFEEIAM-LVQSALDGYPVCIFAYGQTGSGKTFTMEGGPGGDPQLEG 432

  Fly   128 IIPRTFEQIWLHINRT--ENFQFLVDVSYLEIYMEELRDLL-----KPNSKHLEVRERGSGV--- 182
            :|||....::......  :.:.:....||:|||.|.:||||     |......|:|..|.|.   
Human   433 LIPRALRHLFSVAQELSGQGWTYSFVASYVEIYNETVRDLLATGTRKGQGGECEIRRAGPGSEEL 497

  Fly   183 ------YVPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMCDTETNTI 241
                  |||    ::|:...|.:  :.:..:||.|..|..||.|||||::|.::|. .:..:..:
Human   498 TVTNARYVP----VSCEKEVDAL--LHLARQNRAVARTAQNERSSRSHSVFQLQIS-GEHSSRGL 555

  Fly   242 KVG-KLNLIDLAGSERQSKTGA----SAERLKEASKINLALSSLGNVISALAESSPHVPYRDSKL 301
            :.| .|:|:|||||||.....|    ..|||:|...||.:||:||.||.||:....|||||:|||
Human   556 QCGAPLSLVDLAGSERLDPGLALGPGERERLRETQAINSSLSTLGLVIMALSNKESHVPYRNSKL 620

  Fly   302 TRLLQDSLGGNSKTIMIANIGPSNYNYNETLTTLRYASRAK 342
            |.|||:||||::|.:|..||.|...|.:|:|.:||:||:.:
Human   621 TYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASKVR 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp68DNP_001261726.1 Motor_domain 18..344 CDD:277568 120/301 (40%)
KISc 20..351 CDD:214526 120/301 (40%)
GBP_C <479..576 CDD:303769
coiled coil 547..558 CDD:293879
KIFC1XP_016866325.1 SPEC <145..294 CDD:295325
SlyX 215..268 CDD:294687
Microtub_bd 297..>317 CDD:293401
KISc_C_terminal 308..661 CDD:276817 120/299 (40%)
KISc 310..661 CDD:214526 120/299 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2170
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.