DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp68D and Ggamma1

DIOPT Version :10

Sequence 1:NP_524029.2 Gene:Klp68D / 39332 FlyBaseID:FBgn0004381 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_523662.1 Gene:Ggamma1 / 35881 FlyBaseID:FBgn0004921 Length:70 Species:Drosophila melanogaster


Alignment Length:44 Identity:11/44 - (25%)
Similarity:21/44 - (47%) Gaps:6/44 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 DPQDAKLKEYQEEIERLKRLIGPQQQQRSE------KQVTAKKQ 390
            |...:.|::.:..:|:|:|.....:|..||      |.:|..:|
  Fly     2 DVMSSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQ 45

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp68DNP_524029.2 KISc 20..351 CDD:214526
Smc <431..>580 CDD:440809
Ggamma1NP_523662.1 GGL 8..65 CDD:238024 10/38 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.