DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp68D and CG32318

DIOPT Version :9

Sequence 1:NP_001261726.1 Gene:Klp68D / 39332 FlyBaseID:FBgn0004381 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster


Alignment Length:201 Identity:60/201 - (29%)
Similarity:87/201 - (43%) Gaps:58/201 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRRPGTGSSQTPNECVQVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVDGNKEQRKVFTY 69
            ||:|...|:|.    :||.||.||:::|||..||.|||:|...|.||....:   :.:..|.||:
  Fly     9 SRQPQKKSNQN----IQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTL---DSKLTKKFTF 66

  Fly    70 DAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFE 134
            |.::...:.|..:|..||.||:..||.|:|..:|||||||.                        
  Fly    67 DRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN------------------------ 107

  Fly   135 QIWLHINRTENFQFLVDVSYLEIYME-ELRD----LLKPNSKHLEVRERGSGVYVPNLHAINCKS 194
                  |........::|..:|.|.: ||.|    .||.||:|          |:|.      ..
  Fly   108 ------NLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQH----------YLPR------AQ 150

  Fly   195 VEDMIK 200
            ||.:::
  Fly   151 VESLVR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp68DNP_001261726.1 Motor_domain 18..344 CDD:277568 55/188 (29%)
KISc 20..351 CDD:214526 55/186 (30%)
GBP_C <479..576 CDD:303769
coiled coil 547..558 CDD:293879
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 38/95 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.