DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp68D and klp2

DIOPT Version :9

Sequence 1:NP_001261726.1 Gene:Klp68D / 39332 FlyBaseID:FBgn0004381 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_593458.1 Gene:klp2 / 2543360 PomBaseID:SPAC664.10 Length:817 Species:Schizosaccharomyces pombe


Alignment Length:354 Identity:128/354 - (36%)
Similarity:189/354 - (53%) Gaps:41/354 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RPGTGSSQTPNECVQVVVRCRPMSNRERSERSPEVVNVYPNRGVVELQNVVDGNKEQRKVFTYDA 71
            ||..|.    .|..|:..   |..|.|.|  :.|:|...|...:.       ||..::..|.:|.
pombe   481 RPPLGD----GESAQIAF---PDQNSEAS--TIEIVAQAPGSSLT-------GNGIKQYAFNFDR 529

  Fly    72 AYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRGNDELMGIIPRTFEQI 136
            .:....|...:::| :..|:.|.::|:|.|||||||||:|||.||      ....|:||.:...|
pombe   530 VFSPETTNEDVFNE-LSQLIQSAMDGYNVCIFAYGQTGSGKTHTM------SSNTGMIPSSVRMI 587

  Fly   137 WLHINRT-----ENFQFLVDVSYLEIYMEELRDLL------KPNSKHLEVRE--RGSGVYVPNLH 188
            :   ||:     ..:::.::..:||||.|.:.|||      :...|.||:..  :.....:.|:.
pombe   588 Y---NRSTSLKERGWEYRMEGQFLEIYNETIIDLLASGNEEEKGKKKLEIYHDTKAGRTTITNIT 649

  Fly   189 AINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMCDTETNTIKVGKLNLIDLAG 253
            :....:.|.:..::...:|||:|..||.||||||||::||:.:...::.|.......||||||||
pombe   650 SEPLDTPEQVTWLLDQASKNRSVAATNANEHSSRSHSVFMLHLNGSNSTTGETCRSTLNLIDLAG 714

  Fly   254 SERQSKTGASAERLKEASKINLALSSLGNVISAL--AESSPHVPYRDSKLTRLLQDSLGGNSKTI 316
            |||.|.:.:..|||||...||.:||.||:||.||  .:...::|||:||||.|||.||||||||:
pombe   715 SERLSSSQSVGERLKETQAINKSLSCLGDVIHALGSGKEGTYIPYRNSKLTNLLQYSLGGNSKTL 779

  Fly   317 MIANIGPSNYNYNETLTTLRYASRAKSIQ 345
            |..||.|...:..|||.:||:|::..:.|
pombe   780 MFVNISPLKQHVPETLCSLRFATKVNNTQ 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp68DNP_001261726.1 Motor_domain 18..344 CDD:277568 124/340 (36%)
KISc 20..351 CDD:214526 124/341 (36%)
GBP_C <479..576 CDD:303769
coiled coil 547..558 CDD:293879
klp2NP_593458.1 GAS 291..470 CDD:290562
Kinetocho_Slk19 309..399 CDD:289479
Microtub_bd 452..>480 CDD:293401
KISc_C_terminal 471..809 CDD:276817 128/354 (36%)
Kinesin 479..807 CDD:278646 127/351 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2170
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.