DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp68D and KIF4A

DIOPT Version :10

Sequence 1:NP_524029.2 Gene:Klp68D / 39332 FlyBaseID:FBgn0004381 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_036442.3 Gene:KIF4A / 24137 HGNCID:13339 Length:1232 Species:Homo sapiens


Alignment Length:273 Identity:53/273 - (19%)
Similarity:92/273 - (33%) Gaps:95/273 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NTHLLHGVIHSNGYAHLLCLNGREGGSGFLTGRAIMDFWDRLCSSLAVRKASVMDVSRKYGMDYR 135
            ||.|::.::...|:                |...:.::|.:..:...|:...|:...        
Human   679 NTDLINRILLDAGF----------------TNELVQNYWSKQKNIKGVKARFVVTDG-------- 719

  Fly   136 LLHGITR------GCSW------YSEWGYE--FKSGSYALTKE--------AYQSAVDTLSAIPL 178
               ||||      |.:|      |.:..|:  ..:.:|..|..        ||:|.:....|:  
Human   720 ---GITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYFNKSGPGAYESGIMVSKAV-- 779

  Fly   179 SEFLFQGR--KPRTQLHSIISFYQSLSCSELVTVK-DLFSFLLQMIRENSSKPASKSSVLCAWSK 240
             |...||:  ||                 .:|.:| |:.|::     ||.:|.:.:..  ||...
Human   780 -ELYIQGKLLKP-----------------AVVGIKIDVNSWI-----ENFTKTSIRDP--CAGPV 819

  Fly   241 SDVERVQQTMVKI--------LKASGRPQANWVTRWALKRSICKSASPQLIDYCLKHFGGVLVDD 297
            .|.:|....|..:        |.|:.....|.:.|:.  ..|..|....|::..|..|      :
Human   820 CDCKRNSDVMDCVILDDGGFLLMANHDDYTNQIGRFF--GEIDPSMMRHLVNISLYAF------N 876

  Fly   298 GSRVVSSRCNPGS 310
            .|....|.|:||:
Human   877 KSYDYQSVCDPGA 889

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp68DNP_524029.2 KISc 20..351 CDD:214526 53/273 (19%)
Smc <431..>580 CDD:440809
KIF4ANP_036442.3 KISc_KIF4 8..337 CDD:276823
PRK11281 383..>646 CDD:481316
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 496..515
Smc <517..>1033 CDD:440809 53/273 (19%)
Required for the interaction with PRC1. /evidence=ECO:0000269|PubMed:15297875 663..1232 53/273 (19%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:11736643 793..798 2/4 (50%)
Globular 1000..1232
CRD, required for [4Fe-4S] cluster binding and localization to the spindle midzone and midbody during anaphase and telophase. /evidence=ECO:0000269|PubMed:29848660 1086..1144
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1122..1142
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.