DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp68D and Kifc5b

DIOPT Version :9

Sequence 1:NP_001261726.1 Gene:Klp68D / 39332 FlyBaseID:FBgn0004381 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_444403.2 Gene:Kifc5b / 16580 MGIID:2137414 Length:672 Species:Mus musculus


Alignment Length:300 Identity:119/300 - (39%)
Similarity:171/300 - (56%) Gaps:32/300 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RKVFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTME-GVRGNDELMG 127
            |..|::|..:...:.|..::.|:.. ||.|.|:|:..|||||||||:||||||| |.||:.:|.|
Mouse   368 RHDFSFDRVFPPGSKQEEVFEEIAM-LVQSALDGYPVCIFAYGQTGSGKTFTMEGGPRGDPQLAG 431

  Fly   128 IIPRTFEQIWLHINRT--ENFQFLVDVSYLEIYMEELRDLL-----KPNSKHLEVRERGSGV--- 182
            :|||....::......  :.:.:....||:|||.|.:||||     |......|:|....|.   
Mouse   432 LIPRAMRHLFSVAQEMSGQGWTYSFVASYVEIYNETVRDLLATGPRKGQGGECEIRRASPGSEEL 496

  Fly   183 ------YVPNLHAINC-KSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMCDTETNT 240
                  |||    ::| |.||   .::.:.::||.|..|..|:.|||||::|.::|. .:.....
Mouse   497 TVTNARYVP----VSCEKEVE---ALLHLAHQNRAVAHTAQNKRSSRSHSVFQLQIS-GEHAARG 553

  Fly   241 IKVG-KLNLIDLAGSERQSK----TGASAERLKEASKINLALSSLGNVISALAESSPHVPYRDSK 300
            ::.| .|||:|||||||...    .....:||:|...||.:||:||.||.||:....|||||:||
Mouse   554 LQCGAPLNLVDLAGSERLDPGLPLGPGERDRLRETQAINSSLSTLGLVIMALSNKESHVPYRNSK 618

  Fly   301 LTRLLQDSLGGNSKTIMIANIGPSNYNYNETLTTLRYASR 340
            ||.|||:||||::|.:|..||.|...|.:|:|.:||:||:
Mouse   619 LTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRFASK 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp68DNP_001261726.1 Motor_domain 18..344 CDD:277568 119/299 (40%)
KISc 20..351 CDD:214526 119/299 (40%)
GBP_C <479..576 CDD:303769
coiled coil 547..558 CDD:293879
Kifc5bNP_444403.2 TPR_MLP1_2 138..249 CDD:285204
SYCE1 169..298 CDD:291886
KISc_C_terminal 307..664 CDD:276817 119/299 (40%)
KISc 309..665 CDD:214526 119/299 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2170
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.