DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp68D and Ggamma1

DIOPT Version :10

Sequence 1:NP_524029.2 Gene:Klp68D / 39332 FlyBaseID:FBgn0004381 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_314554.2 Gene:Ggamma1 / 1275316 VectorBaseID:AGAMI1_005034 Length:70 Species:Anopheles gambiae


Alignment Length:43 Identity:13/43 - (30%)
Similarity:25/43 - (58%) Gaps:4/43 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 QQQRSEKQVTAKKQRVKKPKKETVTKEMSDSLQVSTIEQPVED 419
            ||||:   :|.:.:|....::.||::.::|.::..| |...||
Mosquito     9 QQQRA---ITEQLRREAAIQRITVSQAVADIVKYVT-EHQAED 47

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp68DNP_524029.2 KISc 20..351 CDD:214526
Smc <431..>580 CDD:440809
Ggamma1XP_314554.2 GGL 8..65 CDD:238024 13/43 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.