DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp68D and kifc1

DIOPT Version :9

Sequence 1:NP_001261726.1 Gene:Klp68D / 39332 FlyBaseID:FBgn0004381 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_002938712.2 Gene:kifc1 / 100038104 XenbaseID:XB-GENE-489355 Length:650 Species:Xenopus tropicalis


Alignment Length:342 Identity:138/342 - (40%)
Similarity:209/342 - (61%) Gaps:28/342 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VQVVVRCRPMSNRERSERSPEVVNVYP---NRGVV----ELQNVVDGNKEQRKV-FTYDAAYDAS 76
            ::|..|.||...:|:...:..:  .||   ::.||    |..:|....|:..|. |.:|..:..|
 Frog   302 IRVFCRVRPTLTQEKELPAGHI--SYPSNDDKAVVLSKMEESHVGREKKDAVKYDFNFDCVFPPS 364

  Fly    77 ATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGVRG-NDELMGIIPRTFEQIWLHI 140
            .:|.:::.|:.. ||.|.|:|:..|||||||||:|||:||||... .|:.:|:|||...||:...
 Frog   365 CSQESVFEEISL-LVQSALDGYPVCIFAYGQTGSGKTYTMEGPEDITDDTIGMIPRAIGQIFSSA 428

  Fly   141 N--RTENFQFLVDVSYLEIYMEELRDLL--KPNSK-HLEVRE---RGSGVYVPNLHAINCKSVED 197
            .  :.:.:||....|:||||.|.|||||  :|:.| ..|:|:   ..|.:||.||..:...|||:
 Frog   429 EELKAKGWQFTFTASFLEIYNETLRDLLINRPDKKLEYEIRKVNSSNSQLYVTNLRYVEVSSVEE 493

  Fly   198 MIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIE----MCDTETNTIKVGKLNLIDLAGSERQS 258
            :..::::...||:|..|.:|:.|||||::|.::||    ..|.:|:::    |:|||||||||..
 Frog   494 VHDLLRIAKANRSVAKTAINDRSSRSHSVFQLRIEGENKQRDLKTSSV----LSLIDLAGSERLD 554

  Fly   259 KTGASAERLKEASKINLALSSLGNVISALAESSPHVPYRDSKLTRLLQDSLGGNSKTIMIANIGP 323
            ::.:|.:||||...||.:||:||.||::|.....|:|||:||||.|||:|||||:|.:|..||.|
 Frog   555 RSLSSGDRLKETQCINTSLSTLGMVITSLCNKDSHIPYRNSKLTYLLQNSLGGNAKVLMFVNISP 619

  Fly   324 SNYNYNETLTTLRYASR 340
            ...|:.|:|.:||:||:
 Frog   620 LEENFAESLNSLRFASK 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp68DNP_001261726.1 Motor_domain 18..344 CDD:277568 138/342 (40%)
KISc 20..351 CDD:214526 138/342 (40%)
GBP_C <479..576 CDD:303769
coiled coil 547..558 CDD:293879
kifc1XP_002938712.2 Mplasa_alph_rch <121..>287 CDD:275316
KISc_C_terminal 299..642 CDD:276817 138/342 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2170
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.