DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and CPR2

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_011924.1 Gene:CPR2 / 856454 SGDID:S000001099 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:61/151 - (40%)
Similarity:89/151 - (58%) Gaps:16/151 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VGDIDIELWARECPKACRNFVQLCL-----EGYYKNTEFHRLVKGFIVQGGD-PNGDGTGGESIY 79
            ||.|.|.|:.:.|||..:||.:|..     :|:..:| |||::..|:||||| .:|.|.||:|||
Yeast    49 VGRIVIGLYGKVCPKTAKNFYKLSTTTNSKKGFIGST-FHRVIPNFMVQGGDFTDGTGVGGKSIY 112

  Fly    80 GQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPE---LQNKNTLFGKIT-GDTIYN 140
            |..|.|| :..|::.|:|.:.|||.|||.||||||.|  .|.|   |..|:.:||::. |..:.|
Yeast   113 GDTFPDE-NFTLKHDRKGRLSMANRGKDTNGSQFFIT--TTEEASWLDGKHVVFGQVVDGMDVVN 174

  Fly   141 MLKLEDGIVDHQERPMHAHRI 161
            .::....  |..::|:.|.:|
Yeast   175 YIQHVSR--DANDKPLEAVKI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 61/151 (40%)
CPR2NP_011924.1 cyclophilin 37..197 CDD:412213 61/151 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.