DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and CPR8

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_014425.3 Gene:CPR8 / 855762 SGDID:S000005311 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:43/186 - (23%)
Similarity:71/186 - (38%) Gaps:33/186 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YIQEPPTSGKVLLKTTVGD----------IDIELWARECPKACRNFVQ---------LCLEGYYK 50
            |..:||.:..|.:.....|          |.|:|:....||....|.|         .....|..
Yeast    40 YAPDPPITHNVNIGIVFTDPESSEEAGRLITIDLYGTMVPKTVMTFCQYVDSVKDRLASRHSYSP 104

  Fly    51 NTEFHRLVKGFIVQGGDPNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFF 115
            ..:|.:::....::|...:........:......:|.|| |.:.|.|.|.|.   |||.|.:|..
Yeast   105 ERDFDKILPNGAIEGSSVSSSSIEETEMLAPKLPEENHS-LIHDRPGRVSMI---KDDKGLKFII 165

  Fly   116 TFAPTPELQNKNTLFGKITG------DTIYNMLKLEDGIVDHQERPMHAHRIVSTE 165
            ..:.|| |:.::.:||::|.      |.:.|:...|:|   ..|:|:....|.|.|
Yeast   166 ETSETP-LEGESVVFGQVTAGLKDLMDKLANVKTDENG---KPEQPITIGYISSQE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 42/183 (23%)
CPR8NP_014425.3 cyclophilin 65..210 CDD:412213 35/152 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.