DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and CPR3

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_013633.1 Gene:CPR3 / 854897 SGDID:S000004543 Length:182 Species:Saccharomyces cerevisiae


Alignment Length:131 Identity:54/131 - (41%)
Similarity:79/131 - (60%) Gaps:10/131 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EPPTSGKVLLKTTVGDIDIELWARECPKACRNFVQLCL--EGY-YKNTEFHRLVKGFIVQGGDPN 69
            :|..:|     |.:|.|:.||:....||...||..||.  :|: ||...|||::..|::||||.:
Yeast    27 DPAVNG-----TKIGRIEFELYDNVVPKTAENFRALCTGEKGWGYKGVPFHRIIPDFMIQGGDTD 86

  Fly    70 -GDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKI 133
             .:|.||:||||..|.||...: ::.:.||:.|||:|.:.||||||.|..|.|.|..|:.:||::
Yeast    87 LTNGFGGKSIYGSKFADENFVK-KHDKAGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEV 150

  Fly   134 T 134
            |
Yeast   151 T 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 54/131 (41%)
CPR3NP_013633.1 cyclophilin_ABH_like 23..180 CDD:238907 54/131 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343467
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.