DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and CPR1

DIOPT Version :10

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_010439.1 Gene:CPR1 / 851733 SGDID:S000002562 Length:162 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:56/147 - (38%)
Similarity:85/147 - (57%) Gaps:13/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNIYIQEPPTSGKVLLKTTVGDIDIELWARECPKACRNFVQLCL--EGY-YKNTEFHRLVKGFI 62
            ||.:|. :....|:     .:|.:..:|:....||...||..||.  :|: |..:.|||::..|:
Yeast     1 MSQVYF-DVEADGQ-----PIGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDFM 59

  Fly    63 VQGGD-PNGDGTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNK 126
            :|||| ..|:||||:||||..|.|| :.:..:.|.||:.|||:|.:.||||||.|..|.|.|..|
Yeast    60 LQGGDFTAGNGTGGKSIYGGKFPDE-NFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGK 123

  Fly   127 NTLFGKITGDTIYNMLK 143
            :.:||::...  |:::|
Yeast   124 HVVFGEVVDG--YDIVK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 53/140 (38%)
PTZ00121 <279..>426 CDD:173412
CWC27_CTD 390..451 CDD:412084
CPR1NP_010439.1 cyclophilin_ABH_like 2..160 CDD:238907 55/146 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.