DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and CPR6

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_013317.1 Gene:CPR6 / 850914 SGDID:S000004206 Length:371 Species:Saccharomyces cerevisiae


Alignment Length:438 Identity:111/438 - (25%)
Similarity:175/438 - (39%) Gaps:132/438 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GDIDIELWARECPKACRNFVQLCLEG-------------YYKNTEFHRLVKGFIVQGGD-PNGDG 72
            |.|..||:....||...||::|| ||             .||.:.|||::|.|:.|.|| .|.:|
Yeast    18 GRIVFELYNDIVPKTAENFLKLC-EGNAGMAKTKPDVPLSYKGSIFHRVIKDFMCQFGDFTNFNG 81

  Fly    73 TGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGK-ITGD 136
            |||||||.:.|:|| :..:::.:..|:.|||:|.:.||||.|.|..|||.|..|:.:||: |.|.
Yeast    82 TGGESIYDEKFEDE-NFTVKHDKPFLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIQGK 145

  Fly   137 TIYNML----------------KLED-GIV-DHQERPMHAHRIVSTEVLSNPFDDIVPRILSQPS 183
            .|..::                |::| |:: |..:.|.:|....:.|...| ::|::        
Yeast   146 RIVRLIENQQCDQENNKPLRDVKIDDCGVLPDDYQVPENAEATPTDEYGDN-YEDVL-------- 201

  Fly   184 TKSKKTKKERQGVKNFGLLSFGEEAEGDEEETNVYVKQNAGKAKSLHDVTDDPKLSKEPIRVPKV 248
                 .:.|:..:|||           |.....:...:|.|        |:..|.....:.:.|.
Yeast   202 -----KQDEKVDLKNF-----------DTVLKAIETVKNIG--------TEQFKKQNYSVALEKY 242

  Fly   249 EKADIEEHLSDDCPEDSVKDKPSTASSDLIKMKLSKRSKSGADKKVQPVEEKSDSEDDEDVLLTR 313
            .|.|  :.|.:..|||                                                .
Yeast   243 VKCD--KFLKEYFPED------------------------------------------------L 257

  Fly   314 EEEQSRKVSEEKSKIREEIA--SLK-KQYQMDKQSKDKLVNGQ---EKA-AKSNEIKGSSENHYI 371
            |:||..|:::.|..|...||  :|| |.|:....:..:::..:   ||| ||:...:|.:..| :
Yeast   258 EKEQIEKINQLKVSIPLNIAICALKLKDYKQVLVASSEVLYAEAADEKAKAKALYRRGLAYYH-V 321

  Fly   372 NDFIESKEKYTAKVKLQPKGQSREAFTLSLL--SKFRTKLDNLKQKSS 417
            ||...:..........||    .:|..|..:  :|.:.|..|.|.|.|
Yeast   322 NDTDMALNDLEMATTFQP----NDAAILKAIHNTKLKRKQQNEKAKKS 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 64/188 (34%)
CPR6NP_013317.1 cyclophilin_ABH_like 4..173 CDD:238907 57/156 (37%)
TPR repeat 219..264 CDD:276809 14/102 (14%)
TPR repeat 269..303 CDD:276809 8/33 (24%)
TPR repeat 308..334 CDD:276809 6/26 (23%)
TPR_1 311..341 CDD:395414 6/34 (18%)
TPR repeat 342..368 CDD:276809 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.