DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and CPR4

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_009995.1 Gene:CPR4 / 850433 SGDID:S000000665 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:262 Identity:62/262 - (23%)
Similarity:103/262 - (39%) Gaps:52/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YIQEPPTSGKVLLKTTV------------GDIDIELWARECPKACRNFVQLC------LEG---- 47
            |...||.:.:.::  |:            .|:..||:....||...||..|.      :||    
Yeast    39 YEPSPPATHRGII--TIEYFDPVSKSMKEADLTFELYGTVVPKTVNNFAMLAHGVKAVIEGKDPN 101

  Fly    48 -----YYKNTEFHRLVKGFIVQGGDPNGDGTGGESIYGQPFKDE-FHSRLRYTRRGLVGMANSGK 106
                 .|:.|:.:::.....:|||....| .|..::||..|.|| |:  |::.|...:.||..|.
Yeast   102 DIHTYSYRKTKINKVYPNKYIQGGVVAPD-VGPFTVYGPKFDDENFY--LKHDRPERLAMAYFGP 163

  Fly   107 DDNGSQFFFTFAP--TPELQNKNTLFGKITG--DTIYNMLKLEDGIVDHQERPMHAHRIV--STE 165
            |.|.|:|..|...  ..||..|:.:||:||.  |.:.:.::..:  .|...:|.|..|.:  ..|
Yeast   164 DSNTSEFIITTKADGNEELDGKSVVFGQITSGLDQLMDAIQYTE--TDEYGKPQHELRFLYFVLE 226

  Fly   166 VLSNPFDDIVPRILSQPSTKSKKTKKERQGVKNFGLLSFGEEAEGDEEETNVYVKQNAGKAKSLH 230
            :|.      :..||...:..::|.:|.|.|.     :|.|...|........|.........:.:
Yeast   227 ILK------ISNILDLHAAYTEKVEKFRNGD-----VSVGSTLENIFRNDKAYTPLTTSTGTTAY 280

  Fly   231 DV 232
            |:
Yeast   281 DL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 50/203 (25%)
CPR4NP_009995.1 cyclophilin 67..219 CDD:238194 44/156 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.