DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and AT1G01940

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_171696.2 Gene:AT1G01940 / 839309 AraportID:AT1G01940 Length:160 Species:Arabidopsis thaliana


Alignment Length:158 Identity:71/158 - (44%)
Similarity:97/158 - (61%) Gaps:5/158 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGDGTGGESIY 79
            |.|.|.:|||..|::..|.||:..||:.||..|||..|.|||.:|||::|||||.|.|.||.||:
plant     3 VTLHTNLGDIKCEIFCDEVPKSAENFLALCASGYYDGTIFHRNIKGFMIQGGDPKGTGKGGTSIW 67

  Fly    80 GQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGK-ITGDTIYNML- 142
            |:.|.||....|::..||::.|||||.:.||||||.|:|..|.|....|:||| |.|..:.::: 
plant    68 GKKFNDEIRDSLKHNARGMLSMANSGPNTNGSQFFITYAKQPHLNGLYTIFGKVIHGFEVLDIME 132

  Fly   143 KLEDGIVDHQERPMHAHRIVSTEVLSNP 170
            |.:.|..|   ||:...|:....:.:||
plant   133 KTQTGPGD---RPLAEIRLNRVTIHANP 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 71/158 (45%)
AT1G01940NP_171696.2 Cyclophilin_PPIL3_like 1..153 CDD:238909 69/152 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.