DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and PUB49

DIOPT Version :9

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_201554.1 Gene:PUB49 / 836889 AraportID:AT5G67530 Length:595 Species:Arabidopsis thaliana


Alignment Length:284 Identity:94/284 - (33%)
Similarity:140/284 - (49%) Gaps:38/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QEPPTSGKVLLKTTVGDIDIELWARECPKACRNFVQLCLEGYYKNTEFHRLVKGFIVQGGDPNGD 71
            :.|...|.|..:||.||::|||.....|:||.||:.||..|||....|||.::.|::|||||.|.
plant   338 KNPKKKGYVQFQTTHGDLNIELHCDIAPRACENFITLCERGYYNGVAFHRSIRNFMIQGGDPTGT 402

  Fly    72 GTGGESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKITGD 136
            |.|||||:|:|||||.:|:|.::.||:|.|||||...||||||..:.....|..|:|:||.:.|.
plant   403 GKGGESIWGKPFKDEPNSKLLHSGRGVVSMANSGPHTNGSQFFVLYKSATHLNYKHTVFGGVVGG 467

  Fly   137 TIYNMLKLEDGIVDHQERPMHAHRIVSTEVLSNPFDDIVPRILSQPSTKSKKTKKERQGVKNFGL 201
             :..:..:|:..||..:||:...:|:...|..||:.::..   .:...|::|.|.|.:.::..|.
plant   468 -LATLAAMENVPVDESDRPLEEIKIIEASVFVNPYTELDE---EEEKEKAEKEKNEDKDIEKIGS 528

  Fly   202 LSFGEEAEGDEEETNVYVKQNAGKAKSLHDVTDDPKLSKEPIRVPKVEKADIEEHLSDDCPEDSV 266
            . :.....|..|         ||....               .|.|..||         ....:.
plant   529 W-YSNPGSGTTE---------AGAGGG---------------GVGKYLKA---------MSSTAT 559

  Fly   267 KDKPSTASSDLIKMKLSKRSKSGA 290
            ||...:..||:..:.:||:.|:.|
plant   560 KDTKGSLDSDISTIGVSKKRKTTA 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 73/169 (43%)
PUB49NP_201554.1 RING 39..101 CDD:302633
cyclophilin_RING 345..502 CDD:238904 71/157 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.