DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10907 and AT3G55920

DIOPT Version :10

Sequence 1:NP_648508.1 Gene:CG10907 / 39331 FlyBaseID:FBgn0036207 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_567029.1 Gene:AT3G55920 / 824758 AraportID:AT3G55920 Length:228 Species:Arabidopsis thaliana


Alignment Length:123 Identity:56/123 - (45%)
Similarity:72/123 - (58%) Gaps:12/123 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GDIDIELWARECPKACRNFVQLCL--EG--------YYKNTEFHRLVKGFIVQGGD-PNGDGTGG 75
            |.|.|.|:....||...||..||.  :|        |:|.:.|||::.||::|||| ..|||.||
plant    73 GRILIGLFGNIVPKTAENFRSLCTGEKGVGNMGKPLYFKGSSFHRIIPGFMIQGGDFTRGDGRGG 137

  Fly    76 ESIYGQPFKDEFHSRLRYTRRGLVGMANSGKDDNGSQFFFTFAPTPELQNKNTLFGKI 133
            |||||..|.|| :.:|::|..|.:.|||||.|.||||||.|...|..|...:.:|||:
plant   138 ESIYGDKFADE-NFKLKHTGPGFLSMANSGPDSNGSQFFITTVTTSWLDGHHVVFGKV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10907NP_648508.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 56/123 (46%)
PTZ00121 <279..>426 CDD:173412
CWC27_CTD 390..451 CDD:412084
AT3G55920NP_567029.1 cyclophilin_ABH_like 59..224 CDD:238907 56/123 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.